(data stored in ACNUC1104 zone)

EMBL: AM420293.FEPG

AM420293.FEPG        Location/Qualifiers
FT   CDS             461744..462829
FT                   /transl_table=11
FT                   /gene="fepG"
FT                   /locus_tag="SACE_0412"
FT                   /product="Fe(3+) enterobactin transport system permease
FT                   protein"
FT                   /function="ABC-type Fe3+-siderophore transport
FT                   system,permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99760"
FT                   /db_xref="GOA:A4F6T6"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6T6"
FT                   /protein_id="CAL99760.1"
FT                   /translation="MTRTVQAPKVAGRRSVRVGPVSGVLRLRPALVLLAGLVLLLLLFV
FT                   LNVGLGEYQISPAEVLTTLVGGGDRAEQVIIWELRMPRSLTGLLVGAALGAAGAIMQAI
FT                   ARNPLASPDMLGITWGAGTAATAVIVLGGSVGTVTGALESVGLPLVALAGGLLVGLAVY
FT                   VLSYRNGVDSYRLVLVGVGMSALAGNATYWLLSVGDVNDAGRAMVWLTGSLNARGWEHV
FT                   VPVAIVLALLVPLTLVGAHVLGALQFDDDTVRGLGIRMDAARGGLLIAAVLLAAVATAA
FT                   AGPIQFVALAVPQIALRLARTAMPPLLTSMVLGAALVVGSDLISRTAFGGIEMPVGIVT
FT                   SVLGAPYLIYLLVRRYREVRA"
     MTRTVQAPKV AGRRSVRVGP VSGVLRLRPA LVLLAGLVLL LLLFVLNVGL GEYQISPAEV        60
     LTTLVGGGDR AEQVIIWELR MPRSLTGLLV GAALGAAGAI MQAIARNPLA SPDMLGITWG       120
     AGTAATAVIV LGGSVGTVTG ALESVGLPLV ALAGGLLVGL AVYVLSYRNG VDSYRLVLVG       180
     VGMSALAGNA TYWLLSVGDV NDAGRAMVWL TGSLNARGWE HVVPVAIVLA LLVPLTLVGA       240
     HVLGALQFDD DTVRGLGIRM DAARGGLLIA AVLLAAVATA AAGPIQFVAL AVPQIALRLA       300
     RTAMPPLLTS MVLGAALVVG SDLISRTAFG GIEMPVGIVT SVLGAPYLIY LLVRRYREVR       360
     A                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page