(data stored in ACNUC1104 zone)

EMBL: AM420293.FHUC

AM420293.FHUC        Location/Qualifiers
FT   CDS             complement(504032..504901)
FT                   /transl_table=11
FT                   /gene="fhuC"
FT                   /locus_tag="SACE_0452"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /function="ABC-type Mn/Zn transport systems, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99800"
FT                   /db_xref="GOA:A4F6X6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6X6"
FT                   /protein_id="CAL99800.1"
FT                   /translation="MTAKPEAGHSGHDSTAVADRAPSRAPAVQLRGAQLSYGTRVLWDG
FT                   LDLDVEPGEFLAVLGPNGSGKTSLLRVLLGLQPLSSGSVKVAGAPAHRGSARIGYIPQQ
FT                   RAVDATLTVRGRDLVGFGLDGHHWGMGIRQRRERRRRVDDALRAVDATAYAKMPLGLLS
FT                   GGEQQRLRVAQALVSDPAVLLCDEPLLSLDIAHQRKVSRLISQQARDAGAAVLFVTHEL
FT                   NPVLPLVDRVLYLVGGRFRIGTPDEVMNSETLSELYGTRIEVARVGGRLVVSGVDEEGC
FT                   HVHEAEQA"
     MTAKPEAGHS GHDSTAVADR APSRAPAVQL RGAQLSYGTR VLWDGLDLDV EPGEFLAVLG        60
     PNGSGKTSLL RVLLGLQPLS SGSVKVAGAP AHRGSARIGY IPQQRAVDAT LTVRGRDLVG       120
     FGLDGHHWGM GIRQRRERRR RVDDALRAVD ATAYAKMPLG LLSGGEQQRL RVAQALVSDP       180
     AVLLCDEPLL SLDIAHQRKV SRLISQQARD AGAAVLFVTH ELNPVLPLVD RVLYLVGGRF       240
     RIGTPDEVMN SETLSELYGT RIEVARVGGR LVVSGVDEEG CHVHEAEQA                   289
//

If you have problems or comments...

PBIL Back to PBIL home page