(data stored in ACNUC1104 zone)

EMBL: AM420293.FTSH

AM420293.FTSH        Location/Qualifiers
FT   CDS             444999..447386
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="SACE_0396"
FT                   /product="putative cell division protein"
FT                   /function="ATP-dependent Zn proteases"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99744"
FT                   /db_xref="GOA:A4F6S0"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6S0"
FT                   /protein_id="CAL99744.1"
FT                   /translation="MTAFLLIYAFSVLFDETRNYREVSTSQALEQIAQGKVKEATIEDK
FT                   EQRVRLTLKDGQTFENSSELIAQYPAGATDQVVQEIRNGQVPSWNTKVTQDSFWVQMLF
FT                   YLVPIGLLVLLLMWMMNNVQGGGNRVLNFGKSKAKQLTKDMPKTLFGDVAGADEAVEEL
FT                   HEIKDFLQNPGRYQALGAKIPKGVLLYGPPGTGKTLLARAVAGEAGVPFYSISGSDFVE
FT                   MFVGVGASRVRDLFEQAKQNAPCIVFVDEIDAVGRQRGAGLGGGHDEREQTLNQLLVEM
FT                   DGFDSRGGIILIAATNRPDILDPALLRPGRFDRQIPVSAPDLRGRRAILGVHSKGKPLA
FT                   QDADLDGLAKRTVGFSGADLENVVNEAALLTARENGQLITAAALEESVDRVIGGPRRKS
FT                   KIISERDKKITAYHEGGHALAAWAMPDLEPVYKLTILPRGRTGGHALVVPEDDKDMMTR
FT                   SEMIARLVFALGGRSAEELVFHEPTTGASSDIEQATKIARAMVTEYGMTARLGAVKYGK
FT                   EEGDPFLGRSAGQQPNYSLEVAHEIDEEVRKLIEAAHTEAWEILNTYRDVLDELVLELI
FT                   EKETLVRKDLERIFTKVEKRPRITAFNDFGGRTPSEKPPIKTPGELARERGEPWPPVTE
FT                   QPPAPAPTPVGAGQQQGDASQSNGVGQYGQHPGTVQFPNPGHQQGQQGGYQQPGQGQYG
FT                   QPVPQAVPPNYGAPPGWTPATSPSGSAPSGAPVPSGAEQGGNQYNWVPSWERSQQPQTG
FT                   PSQPGGGDSNGTPGAQPAQGEGQSGQSPDSTDENGNGTSTNR"
     MTAFLLIYAF SVLFDETRNY REVSTSQALE QIAQGKVKEA TIEDKEQRVR LTLKDGQTFE        60
     NSSELIAQYP AGATDQVVQE IRNGQVPSWN TKVTQDSFWV QMLFYLVPIG LLVLLLMWMM       120
     NNVQGGGNRV LNFGKSKAKQ LTKDMPKTLF GDVAGADEAV EELHEIKDFL QNPGRYQALG       180
     AKIPKGVLLY GPPGTGKTLL ARAVAGEAGV PFYSISGSDF VEMFVGVGAS RVRDLFEQAK       240
     QNAPCIVFVD EIDAVGRQRG AGLGGGHDER EQTLNQLLVE MDGFDSRGGI ILIAATNRPD       300
     ILDPALLRPG RFDRQIPVSA PDLRGRRAIL GVHSKGKPLA QDADLDGLAK RTVGFSGADL       360
     ENVVNEAALL TARENGQLIT AAALEESVDR VIGGPRRKSK IISERDKKIT AYHEGGHALA       420
     AWAMPDLEPV YKLTILPRGR TGGHALVVPE DDKDMMTRSE MIARLVFALG GRSAEELVFH       480
     EPTTGASSDI EQATKIARAM VTEYGMTARL GAVKYGKEEG DPFLGRSAGQ QPNYSLEVAH       540
     EIDEEVRKLI EAAHTEAWEI LNTYRDVLDE LVLELIEKET LVRKDLERIF TKVEKRPRIT       600
     AFNDFGGRTP SEKPPIKTPG ELARERGEPW PPVTEQPPAP APTPVGAGQQ QGDASQSNGV       660
     GQYGQHPGTV QFPNPGHQQG QQGGYQQPGQ GQYGQPVPQA VPPNYGAPPG WTPATSPSGS       720
     APSGAPVPSG AEQGGNQYNW VPSWERSQQP QTGPSQPGGG DSNGTPGAQP AQGEGQSGQS       780
     PDSTDENGNG TSTNR                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page