(data stored in SCRATCH zone)

EMBL: AM420293.ILVB

AM420293.ILVB        Location/Qualifiers
FT   CDS             669203..670885
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="SACE_0604"
FT                   /product="acetolactate synthase large subunit"
FT                   /function="Thiamine pyrophosphate-requiring enzymes
FT                   [acetolactate synthase, pyruvate dehydrogenase
FT                   (cytochrome), glyoxylate carboligase, phosphonopyruvate
FT                   decarboxylase]"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0604"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99949"
FT                   /db_xref="GOA:A4F7C5"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7C5"
FT                   /protein_id="CAL99949.1"
FT                   /translation="MTVESFPNAWHAVVDHLREAGVSVLFGLPGDDLEALCALEKAGMR
FT                   MVLCRDQRNAVCMAAGYAIQSGRPGVCVVGKGPAVANAVGGLLEARSAGAPVVVLAGGT
FT                   GTDRRGSGAFQELDQVPLVTPVVKWAHRIDHPDRVVPAVEKAFLLAGAGAAGPVYLEIP
FT                   DHLAHVPVNRFREWTPPALVGATAVPGTGPAVAALEASRRPVLLVGGGMRHRNGDGAVE
FT                   SFADTAGAAVFSTASGRGTASEEHPLFCGLSGLYCPEAAAELWRTTDLVVAVGTALEET
FT                   ATYGWDGAIGAETPVVQVNCDAGGLSTEYGGLRVVGDGADVLGAWTRALASKPPDESWL
FT                   AAIARCRADVWAHTEDRLARMAADDGLHVAEVLAAIDAVAPPSRILVQENGLQDMWSYF
FT                   YPYHVCRTRGGSLVPSEQTTLGFGAAASAGARLAAPDRPVIAFVGDGAFATVRSELPAL
FT                   RREGVGVVYVVLRNGGYGWLHAQVTSRGLDHRLHPFAADEEEQPEGAVVRQKSQLEDAL
FT                   RDALATCEQGGGPAIVHIDVQLTDTPPGITGLDGDFPSHANEI"
     MTVESFPNAW HAVVDHLREA GVSVLFGLPG DDLEALCALE KAGMRMVLCR DQRNAVCMAA        60
     GYAIQSGRPG VCVVGKGPAV ANAVGGLLEA RSAGAPVVVL AGGTGTDRRG SGAFQELDQV       120
     PLVTPVVKWA HRIDHPDRVV PAVEKAFLLA GAGAAGPVYL EIPDHLAHVP VNRFREWTPP       180
     ALVGATAVPG TGPAVAALEA SRRPVLLVGG GMRHRNGDGA VESFADTAGA AVFSTASGRG       240
     TASEEHPLFC GLSGLYCPEA AAELWRTTDL VVAVGTALEE TATYGWDGAI GAETPVVQVN       300
     CDAGGLSTEY GGLRVVGDGA DVLGAWTRAL ASKPPDESWL AAIARCRADV WAHTEDRLAR       360
     MAADDGLHVA EVLAAIDAVA PPSRILVQEN GLQDMWSYFY PYHVCRTRGG SLVPSEQTTL       420
     GFGAAASAGA RLAAPDRPVI AFVGDGAFAT VRSELPALRR EGVGVVYVVL RNGGYGWLHA       480
     QVTSRGLDHR LHPFAADEEE QPEGAVVRQK SQLEDALRDA LATCEQGGGP AIVHIDVQLT       540
     DTPPGITGLD GDFPSHANEI                                                   560
//

If you have problems or comments...

PBIL Back to PBIL home page