(data stored in ACNUC1104 zone)

EMBL: AM420293.INIA

AM420293.INIA        Location/Qualifiers
FT   CDS             330334..332145
FT                   /transl_table=11
FT                   /gene="iniA"
FT                   /locus_tag="SACE_0295"
FT                   /product="isoniazid inductible gene protein IniA"
FT                   /function="predicted GTPases (dynamin-related)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99644"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6H0"
FT                   /protein_id="CAL99644.1"
FT                   /translation="MIETALVELIDRATAECAEQQRADLHGRLRQIRTRVLDPAQLVLI
FT                   VGESKQGKSELVNAIVNAPVCASGEDVTTVVPTLVRHSDEPTAMLVEHEPARGPAALER
FT                   HPVPIERIRENLGRAVELGRPLTRGEVGLPRAVLEDGLVLMDTPGVGSVSSTLTTTTLA
FT                   VAAEADALLMVSDATQELTTSELAFLKQVTALCPNVAVVQPKIDVTPHWRRVMEVNRKH
FT                   LANAGVTTKIFPVSSVVRMRAMQTKDGQLNAESGFPALLEYLRNEMAGKHAQLTRRLVA
FT                   HNLAEVINQLTTSLKAELAAQNPRTAAETLVELETAQRRAEDLRRMASRWQKTLSDGIS
FT                   ELFADIEFDFRERTWAVMHQVNETFDEADPKEVWDEFIDWLTERLTDAIVQSFEWLDMR
FT                   RERLAEQVADELRREYGDSLPDVERIRPPDPFDAVPKPKEPKSSDYPGLDQVLTSLRGS
FT                   YGGVLMFGLITTMAGLPLMNVVSISAGLLLGSKSLKEEKDSRLRRRQTEARASVQRYVE
FT                   HVVFQVNKEAKDAIRSVHRRLHEHFSQLTEEAQMEVSREIQNIKRSAERSAVDRDRRAR
FT                   EIKKKLEELAVLRQRASLLTQNRITAA"
     MIETALVELI DRATAECAEQ QRADLHGRLR QIRTRVLDPA QLVLIVGESK QGKSELVNAI        60
     VNAPVCASGE DVTTVVPTLV RHSDEPTAML VEHEPARGPA ALERHPVPIE RIRENLGRAV       120
     ELGRPLTRGE VGLPRAVLED GLVLMDTPGV GSVSSTLTTT TLAVAAEADA LLMVSDATQE       180
     LTTSELAFLK QVTALCPNVA VVQPKIDVTP HWRRVMEVNR KHLANAGVTT KIFPVSSVVR       240
     MRAMQTKDGQ LNAESGFPAL LEYLRNEMAG KHAQLTRRLV AHNLAEVINQ LTTSLKAELA       300
     AQNPRTAAET LVELETAQRR AEDLRRMASR WQKTLSDGIS ELFADIEFDF RERTWAVMHQ       360
     VNETFDEADP KEVWDEFIDW LTERLTDAIV QSFEWLDMRR ERLAEQVADE LRREYGDSLP       420
     DVERIRPPDP FDAVPKPKEP KSSDYPGLDQ VLTSLRGSYG GVLMFGLITT MAGLPLMNVV       480
     SISAGLLLGS KSLKEEKDSR LRRRQTEARA SVQRYVEHVV FQVNKEAKDA IRSVHRRLHE       540
     HFSQLTEEAQ MEVSREIQNI KRSAERSAVD RDRRAREIKK KLEELAVLRQ RASLLTQNRI       600
     TAA                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page