(data stored in ACNUC1104 zone)

EMBL: AM420293.LSR2

AM420293.LSR2        Location/Qualifiers
FT   CDS             459845..460195
FT                   /transl_table=11
FT                   /gene="lsr2"
FT                   /locus_tag="SACE_0410"
FT                   /product="probable iron-regulated LSR2 protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99758"
FT                   /db_xref="InterPro:IPR024412"
FT                   /db_xref="InterPro:IPR042254"
FT                   /db_xref="InterPro:IPR042261"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6T4"
FT                   /protein_id="CAL99758.1"
FT                   /translation="MAQKVTVTLVDDLDGGQADETVEFALDGVSYQIDLSNDNATELRD
FT                   ALANYVSSARRAGGRKKPGPRPGAGRSAGGSTSADREQNQAIREWARKRGLKVSDRGRI
FT                   PADVVEQYHKAN"
     MAQKVTVTLV DDLDGGQADE TVEFALDGVS YQIDLSNDNA TELRDALANY VSSARRAGGR        60
     KKPGPRPGAG RSAGGSTSAD REQNQAIREW ARKRGLKVSD RGRIPADVVE QYHKAN           116
//

If you have problems or comments...

PBIL Back to PBIL home page