(data stored in SCRATCH zone)

EMBL: AM420293.MIND2

AM420293.MIND2       Location/Qualifiers
FT   CDS             403784..404944
FT                   /transl_table=11
FT                   /gene="minD2"
FT                   /locus_tag="SACE_0366"
FT                   /product="septum site determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99714"
FT                   /db_xref="InterPro:IPR022521"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6P0"
FT                   /protein_id="CAL99714.1"
FT                   /translation="MSAATSLPSSTPPTAPAGPRPLLITCDAELAEDVLRLAAAAGCDL
FT                   DRAPDPLSVGDRWRTAPLVLLDGPAAEAGVANGLPRRPRVLVLARAPGGDLYRAAFHIG
FT                   AEQEVILPAHEGHLIELLAEAVDRSAPRSGRVLAVIGGSGGAGASVLATGVAVTAARRG
FT                   QRSLLLDCDPLGGGLDLAVGAESTDGVRWSGLSVSGGRVAAGALHDALPQRRVGSGSLA
FT                   VLACDRDGPSSGLTPQAVGAVVDAGRRAGQTVVCDLPRHLSEAALAGLRKADLTLVVVA
FT                   AEVRACAAAARLVAEIRDRTAGRLRLVVRGPASSGLRVSDVGRAVGVEVLTAVRPQTGL
FT                   STALDRGGFCATRAGLRRTVERAASEVLRALGRTGTAPEHALVGAA"
     MSAATSLPSS TPPTAPAGPR PLLITCDAEL AEDVLRLAAA AGCDLDRAPD PLSVGDRWRT        60
     APLVLLDGPA AEAGVANGLP RRPRVLVLAR APGGDLYRAA FHIGAEQEVI LPAHEGHLIE       120
     LLAEAVDRSA PRSGRVLAVI GGSGGAGASV LATGVAVTAA RRGQRSLLLD CDPLGGGLDL       180
     AVGAESTDGV RWSGLSVSGG RVAAGALHDA LPQRRVGSGS LAVLACDRDG PSSGLTPQAV       240
     GAVVDAGRRA GQTVVCDLPR HLSEAALAGL RKADLTLVVV AAEVRACAAA ARLVAEIRDR       300
     TAGRLRLVVR GPASSGLRVS DVGRAVGVEV LTAVRPQTGL STALDRGGFC ATRAGLRRTV       360
     ERAASEVLRA LGRTGTAPEH ALVGAA                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page