(data stored in SCRATCH zone)

EMBL: AM420293.MMPL10

AM420293.MMPL10      Location/Qualifiers
FT   CDS             17128..20220
FT                   /transl_table=11
FT                   /gene="mmpL10"
FT                   /locus_tag="SACE_0014"
FT                   /product="conserved large membrane protein"
FT                   /function="predicted drug exporters of the RND superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99367"
FT                   /db_xref="GOA:A4F5P3"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5P3"
FT                   /protein_id="CAL99367.1"
FT                   /translation="MNATGSDERDGGPLARLSRFVVRRRGAVVCAWVAFAALLNVLVPQ
FT                   LEAVIGQSRVPFVPDSAPSVRALPEMDRRFGGEGANSLVFVVLADESGLSEEDHRYYAE
FT                   LVGRMERDDSRIASVQDAVSQPELADALVSRDGKAIYIPVGLRGENGSPETTAQIKHIR
FT                   ETAQQGRPDSLAVHVTGPMATIADMQDEIERSMLVITAVTVGLITAILLVIYRSVVTAL
FT                   VALALIGLSLGTARAVTAVCGLQFFDVSTFTASLLTAVVLGAGTDYGVFLLSRFHERIR
FT                   AGDDPEQAVITANRRVAAVIAASAGTVIAACSGMALAEVSIFRTTGPAIAVSLAVTLAA
FT                   GLTLTPALLAIAATRGWAMPRRSPENGRWTAIAERVVARPARVLAAGLVVLLLLAAFYP
FT                   AARLSYDERAVQPAATDSNLGYGALGKHFPAGEILPEYLLVNSDHDMRNPQDLAALETA
FT                   AANVAKVDGVRAVRGVTRPTGEPIAEANVGNQVGVVGDRLGAAEEQLGGGQQGIGGLAD
FT                   GAGRLADGTGRLAGGAAELAAGSGRLAAGARSAVDGADQLLNGLNTAHGGLGTAGDGAD
FT                   DAGSAATTLAEGARQLATGLDLARDQTSLAVDGLGLAYHALQADAVCSLDPICAQARKG
FT                   IGDIYVSERDQLLPGLEQAAAAAHKIADGNGDLASGMDDLRGGIATARDGIARLAEGQR
FT                   TMRDQLGALADGAGQAANGAQQLSDNAGLAADGAGRLRDGTANATVSVKELERGLAQAA
FT                   DFLRTVRAESHHPGVGGFYLPPNALSDPRMAMASGMFLSGDGRTARLVVLHSGDPLDRA
FT                   AMDRTGEIVRTAEHALRGTSLDGSGVHNTGSASVNRDLARMSDADFSVFALVALLSVLV
FT                   ILMLLLRSVVAPIYLLVSVILSYAAAMGIAVLFWQFLLGGELDWSVQPIAFVILVAVGA
FT                   DYNMLLMSRIREESDDGSRAGIARAVATTGGVITSAGIIFAASMFALMSGTVDILAQLG
FT                   FTIGVGLLLDTFVVRTLVIPAIAVLLRKWNWWPSKNAGESG"
     MNATGSDERD GGPLARLSRF VVRRRGAVVC AWVAFAALLN VLVPQLEAVI GQSRVPFVPD        60
     SAPSVRALPE MDRRFGGEGA NSLVFVVLAD ESGLSEEDHR YYAELVGRME RDDSRIASVQ       120
     DAVSQPELAD ALVSRDGKAI YIPVGLRGEN GSPETTAQIK HIRETAQQGR PDSLAVHVTG       180
     PMATIADMQD EIERSMLVIT AVTVGLITAI LLVIYRSVVT ALVALALIGL SLGTARAVTA       240
     VCGLQFFDVS TFTASLLTAV VLGAGTDYGV FLLSRFHERI RAGDDPEQAV ITANRRVAAV       300
     IAASAGTVIA ACSGMALAEV SIFRTTGPAI AVSLAVTLAA GLTLTPALLA IAATRGWAMP       360
     RRSPENGRWT AIAERVVARP ARVLAAGLVV LLLLAAFYPA ARLSYDERAV QPAATDSNLG       420
     YGALGKHFPA GEILPEYLLV NSDHDMRNPQ DLAALETAAA NVAKVDGVRA VRGVTRPTGE       480
     PIAEANVGNQ VGVVGDRLGA AEEQLGGGQQ GIGGLADGAG RLADGTGRLA GGAAELAAGS       540
     GRLAAGARSA VDGADQLLNG LNTAHGGLGT AGDGADDAGS AATTLAEGAR QLATGLDLAR       600
     DQTSLAVDGL GLAYHALQAD AVCSLDPICA QARKGIGDIY VSERDQLLPG LEQAAAAAHK       660
     IADGNGDLAS GMDDLRGGIA TARDGIARLA EGQRTMRDQL GALADGAGQA ANGAQQLSDN       720
     AGLAADGAGR LRDGTANATV SVKELERGLA QAADFLRTVR AESHHPGVGG FYLPPNALSD       780
     PRMAMASGMF LSGDGRTARL VVLHSGDPLD RAAMDRTGEI VRTAEHALRG TSLDGSGVHN       840
     TGSASVNRDL ARMSDADFSV FALVALLSVL VILMLLLRSV VAPIYLLVSV ILSYAAAMGI       900
     AVLFWQFLLG GELDWSVQPI AFVILVAVGA DYNMLLMSRI REESDDGSRA GIARAVATTG       960
     GVITSAGIIF AASMFALMSG TVDILAQLGF TIGVGLLLDT FVVRTLVIPA IAVLLRKWNW      1020
     WPSKNAGESG                                                             1030
//

If you have problems or comments...

PBIL Back to PBIL home page