(data stored in ACNUC1104 zone)

EMBL: AM420293.MOAA3

AM420293.MOAA3       Location/Qualifiers
FT   CDS             complement(578372..579562)
FT                   /transl_table=11
FT                   /gene="moaA3"
FT                   /locus_tag="SACE_0523"
FT                   /product="molybdopterin biosynthesis protein MoeA"
FT                   /function="Molybdopterin biosynthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99869"
FT                   /db_xref="GOA:A4F745"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A4F745"
FT                   /protein_id="CAL99869.1"
FT                   /translation="MPEYQQRIAELLAPTPVEPRALEDCLGLALATDLTASIPLPPFDN
FT                   SAMDGYAVRSVDLAGADEQNPVVLPVPEDVPAGRVQNPPLQPGTAHRIMTGAQVPPGAD
FT                   AVIPVERTDGGVTEVRAYAQVQPGAHIRRAGEDVASGATVLSAGTSLTPPQLGVAAAVG
FT                   AERLPVHRPVRVLILSTGSELVAPGTPLEPGQIYESNGLMLASAVRAADADARLLRFVP
FT                   DDVHAFHAVLSPHLDSTDLIITSGGVSAGAYEVVKDALSGNGVEFTKVAMQPGMPQGCG
FT                   RYRGGPAVVALPGNPVSAMVSFEVFVRPVLRAAAGHSRTRREVRQATLTEELVAPAGKR
FT                   QYRRAVFDPATGEVRTQGGTGSHLLTAMAAANCLLEIPEETTTLPEGSTVDVLLVD"
     MPEYQQRIAE LLAPTPVEPR ALEDCLGLAL ATDLTASIPL PPFDNSAMDG YAVRSVDLAG        60
     ADEQNPVVLP VPEDVPAGRV QNPPLQPGTA HRIMTGAQVP PGADAVIPVE RTDGGVTEVR       120
     AYAQVQPGAH IRRAGEDVAS GATVLSAGTS LTPPQLGVAA AVGAERLPVH RPVRVLILST       180
     GSELVAPGTP LEPGQIYESN GLMLASAVRA ADADARLLRF VPDDVHAFHA VLSPHLDSTD       240
     LIITSGGVSA GAYEVVKDAL SGNGVEFTKV AMQPGMPQGC GRYRGGPAVV ALPGNPVSAM       300
     VSFEVFVRPV LRAAAGHSRT RREVRQATLT EELVAPAGKR QYRRAVFDPA TGEVRTQGGT       360
     GSHLLTAMAA ANCLLEIPEE TTTLPEGSTV DVLLVD                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page