(data stored in SCRATCH zone)

EMBL: AM420293.MRCB

AM420293.MRCB        Location/Qualifiers
FT   CDS             complement(427778..429781)
FT                   /transl_table=11
FT                   /gene="mrcB"
FT                   /locus_tag="SACE_0385"
FT                   /product="membrane carboxypeptidase, penicillin-binding
FT                   protein"
FT                   /function="Membrane carboxypeptidase (penicillin-binding
FT                   protein)"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99733"
FT                   /db_xref="GOA:A4F6Q9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Q9"
FT                   /protein_id="CAL99733.1"
FT                   /translation="MSDDATTVLVPAARRRRRLRRALRASVFTATALLLGAVGAFAVGY
FT                   AVWEVPDPRAVATGTQQSIVLQYADGTEMTRIVPGTGNRTMIGSLHEVSPAMRQATLAA
FT                   EDASFYSNGGFDVLGIVRAAYAQLTDSPGGGSTLTQQYIKLATGEDEHTYTRKFKEIVL
FT                   SAKMTNEQPKDEIFKAYLNTAYYGRGAWGVHAASNAYFGKLPRDLDASEAAVLAGAVQK
FT                   PTENDPRVNAAQAAKRWEYVADQMLANHMITGEQRRRMAVPPTRERFAWRGEEMSGPLF
FT                   HIRERVLEELERDGLTARDMHRDGNTVVTNIDRDAQRAAEEAVAAMTEGRSQNLRSALV
FT                   SIEPGTGAIRAYHSGDREIGGFDWARAAQPPGAAMQPFVVAAGLMRGHGLAETYDGTSP
FT                   HEIMGATYRNSGVDCSRTCTARMAMAEASETAFVNMAAKFGPAAVLDAAQRAGMRVDTG
FT                   DDGRRVGLGIATGDYPVSTVDVARGYATLAAGGADHEPRFVRRVLDRTGNEVRSFEPEP
FT                   RTAFGDDPEMSRDVSGNVTESLSWSAWGTNWALDGKRPVAVKSGIAQFGGSPDEAVTAW
FT                   TAGYTPQIATAVSLSASDERGRPQPVVDATSSQAGDVLTGPTWQRFMNAYLADEPVEPF
FT                   PDFGPVGRYAEPSGVPFPPVTTSVPLPPLADR"
     MSDDATTVLV PAARRRRRLR RALRASVFTA TALLLGAVGA FAVGYAVWEV PDPRAVATGT        60
     QQSIVLQYAD GTEMTRIVPG TGNRTMIGSL HEVSPAMRQA TLAAEDASFY SNGGFDVLGI       120
     VRAAYAQLTD SPGGGSTLTQ QYIKLATGED EHTYTRKFKE IVLSAKMTNE QPKDEIFKAY       180
     LNTAYYGRGA WGVHAASNAY FGKLPRDLDA SEAAVLAGAV QKPTENDPRV NAAQAAKRWE       240
     YVADQMLANH MITGEQRRRM AVPPTRERFA WRGEEMSGPL FHIRERVLEE LERDGLTARD       300
     MHRDGNTVVT NIDRDAQRAA EEAVAAMTEG RSQNLRSALV SIEPGTGAIR AYHSGDREIG       360
     GFDWARAAQP PGAAMQPFVV AAGLMRGHGL AETYDGTSPH EIMGATYRNS GVDCSRTCTA       420
     RMAMAEASET AFVNMAAKFG PAAVLDAAQR AGMRVDTGDD GRRVGLGIAT GDYPVSTVDV       480
     ARGYATLAAG GADHEPRFVR RVLDRTGNEV RSFEPEPRTA FGDDPEMSRD VSGNVTESLS       540
     WSAWGTNWAL DGKRPVAVKS GIAQFGGSPD EAVTAWTAGY TPQIATAVSL SASDERGRPQ       600
     PVVDATSSQA GDVLTGPTWQ RFMNAYLADE PVEPFPDFGP VGRYAEPSGV PFPPVTTSVP       660
     LPPLADR                                                                 667
//

If you have problems or comments...

PBIL Back to PBIL home page