(data stored in SCRATCH zone)

EMBL: AM420293.MSRA

AM420293.MSRA        Location/Qualifiers
FT   CDS             134622..135305
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="SACE_0107"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /function="Peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99460"
FT                   /db_xref="GOA:A4F5Y6"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Y6"
FT                   /protein_id="CAL99460.1"
FT                   /translation="MALFGDPFSSHKVRMVEPGDALAGRSTPMPVSEWHAVHPDRRIVP
FT                   PFPEGLATAVVGMGCFWGAERTFWRTEGVWSTAVGYAGGYTPNPTYEEVCSGLTGHTEA
FT                   VLVVFDPKVISYEQVLKVFWENHDPTQGMRQGNDVGTQYRSAIYYADDQQRQIAEASRD
FT                   QFQAALTAAGHGTVSTELAPLRDFYYAETYHQQYLSDAKNPNGYCGIGGTGVSCPVGLA
FT                   MPGDS"
     MALFGDPFSS HKVRMVEPGD ALAGRSTPMP VSEWHAVHPD RRIVPPFPEG LATAVVGMGC        60
     FWGAERTFWR TEGVWSTAVG YAGGYTPNPT YEEVCSGLTG HTEAVLVVFD PKVISYEQVL       120
     KVFWENHDPT QGMRQGNDVG TQYRSAIYYA DDQQRQIAEA SRDQFQAALT AAGHGTVSTE       180
     LAPLRDFYYA ETYHQQYLSD AKNPNGYCGI GGTGVSCPVG LAMPGDS                     227
//

If you have problems or comments...

PBIL Back to PBIL home page