(data stored in SCRATCH zone)

EMBL: AM420293.NAGA

AM420293.NAGA        Location/Qualifiers
FT   CDS             complement(399346..401079)
FT                   /transl_table=11
FT                   /gene="nagA"
FT                   /locus_tag="SACE_0363"
FT                   /product="beta-N-acetylglucosaminidase (putative secreted
FT                   protein)"
FT                   /function="Beta-glucosidase-related glycosidases"
FT                   /EC_number="3.2.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99712"
FT                   /db_xref="GOA:A4F6N8"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6N8"
FT                   /protein_id="CAL99712.1"
FT                   /translation="MAVVSASLTAIGNAAPAGDAHSWATRTMRGMTLEEKVGQLFVTYA
FT                   YGRTADTPHQANRDEFGVATPAEVVQKYHLGGIIHFNWTDSIYEPKQIAELSNGLQRAA
FT                   VTSGAKIPLLISTDQEQGQITRIKEPATQLPGNMALGAGRSPADAERAAVITGQELRAM
FT                   GLAQNFAPSGDVNVNPANPVIGVRSFSSDPALAAELTAAQVRGYQGYGAVTASVKHFPG
FT                   HGDTNQDSHEELPVIEHDRQQWEALDAPPFRAAIDAGTDTVMSAHIVVPKLDDSGEPST
FT                   LSRNVLTGMLREELGFRGVVVTDSLQMEGVRHKHPDAEIPVLALEAGADQLLMPQHLQV
FT                   AIDGVIGAVRSGRLTEKRIDQSVERILRMKAGRGVIDRPFVDVSKVDRIVGSPRNLEAA
FT                   QKITDRTTTLLRNDAAVLPLRQPPGRVLVTGAGASPTKALAGSITARGSQATALETGMK
FT                   PTPQQIDQAVQAAGQNDLTVVLTNAAWNEANASQRDLVRALQRSGKPVVAVAVRDPYDA
FT                   AHVDEVPTWLTTYSDKAVAMESLARTLFGEIAPVGKLPVPVPDPTRPGTDRYPFGHGLS
FT                   W"
     MAVVSASLTA IGNAAPAGDA HSWATRTMRG MTLEEKVGQL FVTYAYGRTA DTPHQANRDE        60
     FGVATPAEVV QKYHLGGIIH FNWTDSIYEP KQIAELSNGL QRAAVTSGAK IPLLISTDQE       120
     QGQITRIKEP ATQLPGNMAL GAGRSPADAE RAAVITGQEL RAMGLAQNFA PSGDVNVNPA       180
     NPVIGVRSFS SDPALAAELT AAQVRGYQGY GAVTASVKHF PGHGDTNQDS HEELPVIEHD       240
     RQQWEALDAP PFRAAIDAGT DTVMSAHIVV PKLDDSGEPS TLSRNVLTGM LREELGFRGV       300
     VVTDSLQMEG VRHKHPDAEI PVLALEAGAD QLLMPQHLQV AIDGVIGAVR SGRLTEKRID       360
     QSVERILRMK AGRGVIDRPF VDVSKVDRIV GSPRNLEAAQ KITDRTTTLL RNDAAVLPLR       420
     QPPGRVLVTG AGASPTKALA GSITARGSQA TALETGMKPT PQQIDQAVQA AGQNDLTVVL       480
     TNAAWNEANA SQRDLVRALQ RSGKPVVAVA VRDPYDAAHV DEVPTWLTTY SDKAVAMESL       540
     ARTLFGEIAP VGKLPVPVPD PTRPGTDRYP FGHGLSW                                577
//

If you have problems or comments...

PBIL Back to PBIL home page