(data stored in ACNUC1104 zone)

EMBL: AM420293.OHRA

AM420293.OHRA        Location/Qualifiers
FT   CDS             complement(221317..221733)
FT                   /transl_table=11
FT                   /gene="ohrA"
FT                   /locus_tag="SACE_0187"
FT                   /product="organic hydroperoxide resistance protein"
FT                   /function="predicted redox protein, regulator of disulfide
FT                   bond formation"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99539"
FT                   /db_xref="GOA:A4F665"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A4F665"
FT                   /protein_id="CAL99539.1"
FT                   /translation="MNVLYTAEATVTGQGRSGHIRSSDGTLDTGLSMPRELGGAGGAGT
FT                   NPEQLFAAGYASCFHSALHLVAGRAKVSSEGSSVTAHVSIGKDREGFGLAAELVVDLPG
FT                   VERERAEELVAQAHEVCPYSRATRDNIEVRVKVA"
     MNVLYTAEAT VTGQGRSGHI RSSDGTLDTG LSMPRELGGA GGAGTNPEQL FAAGYASCFH        60
     SALHLVAGRA KVSSEGSSVT AHVSIGKDRE GFGLAAELVV DLPGVERERA EELVAQAHEV       120
     CPYSRATRDN IEVRVKVA                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page