(data stored in ACNUC1104 zone)

EMBL: AM420293.PE101

AM420293.PE101       Location/Qualifiers
FT   CDS             complement(127304..127558)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99456"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Y2"
FT                   /protein_id="CAL99456.1"
FT                   /translation="MRSVPRALLLVLALALPIAAVVVSFAITDGPRVPDVPAQVRIGSS
FT                   PGPDQPVPSVAPPPGTPPAQLPPPPPDDDDDDHDADHDD"
     MRSVPRALLL VLALALPIAA VVVSFAITDG PRVPDVPAQV RIGSSPGPDQ PVPSVAPPPG        60
     TPPAQLPPPP PDDDDDDHDA DHDD                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page