(data stored in SCRATCH zone)

EMBL: AM420293.PE103

AM420293.PE103       Location/Qualifiers
FT   CDS             complement(131093..132340)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99458"
FT                   /db_xref="GOA:A4F5Y4"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Y4"
FT                   /protein_id="CAL99458.1"
FT                   /translation="MTWQDELQHLDAELAAGRISAEEYRNRRDVALGRAQAQSGPTSGG
FT                   FPQQDPQSGGFPQQDPQSGGFPQQQPGQADPFPPAFNWGAAAQGVPQPGPQGPQPPAGE
FT                   ESTQIVHNPMLQQPPAQHGGDSESTQVVNLNQAPQQQWPGQQQGQQQWPQQQGWSTSDN
FT                   PGTPWGDELPPAEHGDTSWMRQGPEVFESAGKSSKGKLVAGLSIGGVLLAGVIVAGVFY
FT                   FTSGGEEQVPDAQGTTQQQEPPPTTSALPEPPAAKPAPPATSQEVLIASPGGPPHLWNG
FT                   ALDPALLSGPRAGLLQPQQVRDFALQNGFADGWFVGTEGAPRSTLLALRMPDQNTASGL
FT                   VKKYLESQQGLSTVDELSYQGVQVKSAGNVFRTAYVVHNWAVIIDVGADDKAAAQQQFQ
FT                   TVLGQQLQQSPPTVRE"
     MTWQDELQHL DAELAAGRIS AEEYRNRRDV ALGRAQAQSG PTSGGFPQQD PQSGGFPQQD        60
     PQSGGFPQQQ PGQADPFPPA FNWGAAAQGV PQPGPQGPQP PAGEESTQIV HNPMLQQPPA       120
     QHGGDSESTQ VVNLNQAPQQ QWPGQQQGQQ QWPQQQGWST SDNPGTPWGD ELPPAEHGDT       180
     SWMRQGPEVF ESAGKSSKGK LVAGLSIGGV LLAGVIVAGV FYFTSGGEEQ VPDAQGTTQQ       240
     QEPPPTTSAL PEPPAAKPAP PATSQEVLIA SPGGPPHLWN GALDPALLSG PRAGLLQPQQ       300
     VRDFALQNGF ADGWFVGTEG APRSTLLALR MPDQNTASGL VKKYLESQQG LSTVDELSYQ       360
     GVQVKSAGNV FRTAYVVHNW AVIIDVGADD KAAAQQQFQT VLGQQLQQSP PTVRE            415
//

If you have problems or comments...

PBIL Back to PBIL home page