(data stored in SCRATCH zone)

EMBL: AM420293.PE113

AM420293.PE113       Location/Qualifiers
FT   CDS             142234..143502
FT                   /transl_table=11
FT                   /locus_tag="SACE_0115"
FT                   /product="sensor kinase, two-component system"
FT                   /function="putative regulator of cell autolysis"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99468"
FT                   /db_xref="GOA:A4F5Z4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Z4"
FT                   /protein_id="CAL99468.1"
FT                   /translation="MSNPNIDVVPELLTERTVLTTLAALAVLAMFVMLCRSRRVSTSVE
FT                   DATLAALHQVTSAAPHLRAGLTQESADQTAPHLRALLGCIAVGVVDAEGTLLSWDGEAN
FT                   HHYGGLRTRIEQVLRTGKREYVDHGEVACEQRPCVMRHAVVVPLEVEGENRGALVIISA
FT                   GDRRRLLRAAGEVANHVSTQLELAELQESKERLARAEVRALRAQISPHFIYNALNTISS
FT                   QIRNDPEQARDLLQEFADFTRYSFRTSGLYTTLADEIRNIDRYLTLERARFGPDRLKVQ
FT                   LKIAPEVLPVVVPFLALQPLVENAVRHGLANKPGGGTVSVIAEDNGVEALISVDDDGIG
FT                   MNPERLDAELADAHLTGAHVGLGNINNRMRATFGNDYGLVVETEEGAGMKVIMRVPKFA
FT                   PGVRPVPAQAIEEPSVGLAAGPQ"
     MSNPNIDVVP ELLTERTVLT TLAALAVLAM FVMLCRSRRV STSVEDATLA ALHQVTSAAP        60
     HLRAGLTQES ADQTAPHLRA LLGCIAVGVV DAEGTLLSWD GEANHHYGGL RTRIEQVLRT       120
     GKREYVDHGE VACEQRPCVM RHAVVVPLEV EGENRGALVI ISAGDRRRLL RAAGEVANHV       180
     STQLELAELQ ESKERLARAE VRALRAQISP HFIYNALNTI SSQIRNDPEQ ARDLLQEFAD       240
     FTRYSFRTSG LYTTLADEIR NIDRYLTLER ARFGPDRLKV QLKIAPEVLP VVVPFLALQP       300
     LVENAVRHGL ANKPGGGTVS VIAEDNGVEA LISVDDDGIG MNPERLDAEL ADAHLTGAHV       360
     GLGNINNRMR ATFGNDYGLV VETEEGAGMK VIMRVPKFAP GVRPVPAQAI EEPSVGLAAG       420
     PQ                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page