(data stored in ACNUC1104 zone)

EMBL: AM420293.PE122

AM420293.PE122       Location/Qualifiers
FT   CDS             151425..152300
FT                   /transl_table=11
FT                   /locus_tag="SACE_0124"
FT                   /product="possible membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99477"
FT                   /db_xref="GOA:A4F603"
FT                   /db_xref="InterPro:IPR025565"
FT                   /db_xref="UniProtKB/TrEMBL:A4F603"
FT                   /protein_id="CAL99477.1"
FT                   /translation="MATPPGGARPRAVRRQARPYAGPPAYPAVPRWGFPALAWRWPLAL
FT                   PTGPAVDPVRRVAALYATATSTLWIIAGMGGLTAVAELWRYVLLLRSRGEALPATTLAV
FT                   SDALVVTTGVLTLVLGALAGVVVVLWALRAREAATERIGVRSARSDAQFVLGVLVPGLN
FT                   LVVAGSSLSELEHAVLVGEGARERGARPRPSRLVLVWWAAWVASLLLGWTAFLWGFRSG
FT                   TQALADGVVLHVWTNIAVVVLAVVTIRVVRYLTTLLVPADPTELPHLRVLGLRDAPAPP
FT                   RPPRPADAQR"
     MATPPGGARP RAVRRQARPY AGPPAYPAVP RWGFPALAWR WPLALPTGPA VDPVRRVAAL        60
     YATATSTLWI IAGMGGLTAV AELWRYVLLL RSRGEALPAT TLAVSDALVV TTGVLTLVLG       120
     ALAGVVVVLW ALRAREAATE RIGVRSARSD AQFVLGVLVP GLNLVVAGSS LSELEHAVLV       180
     GEGARERGAR PRPSRLVLVW WAAWVASLLL GWTAFLWGFR SGTQALADGV VLHVWTNIAV       240
     VVLAVVTIRV VRYLTTLLVP ADPTELPHLR VLGLRDAPAP PRPPRPADAQ R                291
//

If you have problems or comments...

PBIL Back to PBIL home page