(data stored in SCRATCH zone)

EMBL: AM420293.PE126

AM420293.PE126       Location/Qualifiers
FT   CDS             155413..155994
FT                   /transl_table=11
FT                   /locus_tag="SACE_0128"
FT                   /product="RNA polymerase ECF sigma factor"
FT                   /function="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99481"
FT                   /db_xref="GOA:A4F607"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A4F607"
FT                   /protein_id="CAL99481.1"
FT                   /translation="MTAHLPAAPASAAEAARSWPGRAHQGDMAATEDDFAEFVRVALPG
FT                   LMRYGHALTGNPHDAADLVQTVLEKVGARWAKVSQNCDDPRAYVRKAMANTHVSRWRRT
FT                   RRETLIAEFPDVPAQPRHDRLEDEPVWQALQTLPPRQRAVVVLRFYEGLSEAEIADTLG
FT                   VSCGTVKSQNSKAMATLRKRLGPLVEGGDV"
     MTAHLPAAPA SAAEAARSWP GRAHQGDMAA TEDDFAEFVR VALPGLMRYG HALTGNPHDA        60
     ADLVQTVLEK VGARWAKVSQ NCDDPRAYVR KAMANTHVSR WRRTRRETLI AEFPDVPAQP       120
     RHDRLEDEPV WQALQTLPPR QRAVVVLRFY EGLSEAEIAD TLGVSCGTVK SQNSKAMATL       180
     RKRLGPLVEG GDV                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page