(data stored in ACNUC1104 zone)

EMBL: AM420293.PE127

AM420293.PE127       Location/Qualifiers
FT   CDS             155994..156491
FT                   /transl_table=11
FT                   /locus_tag="SACE_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99482"
FT                   /db_xref="GOA:A4F608"
FT                   /db_xref="UniProtKB/TrEMBL:A4F608"
FT                   /protein_id="CAL99482.1"
FT                   /translation="MGLEDELRRVLRDDKLDIPVRTGAEWSLVAGARRRRKRNTAVAAV
FT                   GGALAATVLVGGGVAAMSYEKRPVPPAVPPVVTSTTSPSGSSGSSPPPQVDPHHPWSPP
FT                   ESSHVTPSPQTSERPSILRDTLPPTTSEPPSTSEPENPPTTSRPSSESGENPSQDESGP
FT                   GG"
     MGLEDELRRV LRDDKLDIPV RTGAEWSLVA GARRRRKRNT AVAAVGGALA ATVLVGGGVA        60
     AMSYEKRPVP PAVPPVVTST TSPSGSSGSS PPPQVDPHHP WSPPESSHVT PSPQTSERPS       120
     ILRDTLPPTT SEPPSTSEPE NPPTTSRPSS ESGENPSQDE SGPGG                       165
//

If you have problems or comments...

PBIL Back to PBIL home page