(data stored in ACNUC1104 zone)

EMBL: AM420293.PE128

AM420293.PE128       Location/Qualifiers
FT   CDS             complement(156543..157103)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0130"
FT                   /product="ferritin family protein"
FT                   /function="Ferritin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99483"
FT                   /db_xref="GOA:A4F609"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:A4F609"
FT                   /protein_id="CAL99483.1"
FT                   /translation="MAITAKKIERRESKFHQLLQEQVHNEFTASQQYIAVAVWFDNEDL
FT                   PRLASHFYKQALEERNHAMMIVQYLMDNNIKPNIPGVPDVRNDFSETRELVALALEQER
FT                   EVTQEIVNLAKTAREEGDYLGEQFMQWFLKEQVEEVSQMSTLLNVVDRSNGNLFDVETF
FT                   LARETVGDEGADSGAPPAAGGTL"
     MAITAKKIER RESKFHQLLQ EQVHNEFTAS QQYIAVAVWF DNEDLPRLAS HFYKQALEER        60
     NHAMMIVQYL MDNNIKPNIP GVPDVRNDFS ETRELVALAL EQEREVTQEI VNLAKTAREE       120
     GDYLGEQFMQ WFLKEQVEEV SQMSTLLNVV DRSNGNLFDV ETFLARETVG DEGADSGAPP       180
     AAGGTL                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page