(data stored in ACNUC1104 zone)

EMBL: AM420293.PE131

AM420293.PE131       Location/Qualifiers
FT   CDS             159722..160063
FT                   /transl_table=11
FT                   /locus_tag="SACE_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99486"
FT                   /db_xref="UniProtKB/TrEMBL:A4F612"
FT                   /protein_id="CAL99486.1"
FT                   /translation="MFLWGWTDSRLIARTLESLRPFDTLDGPVGPAELVGMRDGVLVEV
FT                   TREGADATRVRFVDAGGPADAWTAAHSFLWVVTRRLPVEEALLLGDDTEPLHYREGRIR
FT                   TVPTSGERY"
     MFLWGWTDSR LIARTLESLR PFDTLDGPVG PAELVGMRDG VLVEVTREGA DATRVRFVDA        60
     GGPADAWTAA HSFLWVVTRR LPVEEALLLG DDTEPLHYRE GRIRTVPTSG ERY              113
//

If you have problems or comments...

PBIL Back to PBIL home page