(data stored in ACNUC1104 zone)

EMBL: AM420293.PE132

AM420293.PE132       Location/Qualifiers
FT   CDS             complement(160145..160924)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99487"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:A4F613"
FT                   /protein_id="CAL99487.1"
FT                   /translation="MGEKTTRRPALPSPAERARTIARRGGKGVLMPSGENSARIAPLLH
FT                   HVHPDGAATVLLADEHPLIASAWQAPRGELTAMLEVADPTPVRLREPVRGLLWLTGWLR
FT                   VLEPEQARAEVVRVAEQRPDSRLLDAGHGASVLRLESASMVLADAEGTASVQPEDFLAA
FT                   SPDPFCLMEDGWLRHLELSHRDVVGLLARHLPERLRGGHIRPLGLDKYGLRLRVESADG
FT                   DHDVRLAFSRTVTDAEHLGVELRRLVGCPFLAQQRQG"
     MGEKTTRRPA LPSPAERART IARRGGKGVL MPSGENSARI APLLHHVHPD GAATVLLADE        60
     HPLIASAWQA PRGELTAMLE VADPTPVRLR EPVRGLLWLT GWLRVLEPEQ ARAEVVRVAE       120
     QRPDSRLLDA GHGASVLRLE SASMVLADAE GTASVQPEDF LAASPDPFCL MEDGWLRHLE       180
     LSHRDVVGLL ARHLPERLRG GHIRPLGLDK YGLRLRVESA DGDHDVRLAF SRTVTDAEHL       240
     GVELRRLVGC PFLAQQRQG                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page