(data stored in ACNUC1104 zone)

EMBL: AM420293.PE133

AM420293.PE133       Location/Qualifiers
FT   CDS             161587..162348
FT                   /transl_table=11
FT                   /locus_tag="SACE_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99488"
FT                   /db_xref="UniProtKB/TrEMBL:A4F614"
FT                   /protein_id="CAL99488.1"
FT                   /translation="MPQAVVDHLAARSGPYAGVMGPMLCQASRLAELITELAKAKPAEP
FT                   VALSLVCDTGLGGVPKALSIIEGRQELLALRMVEMPAPSDVDDIWLERVSEFVPEDIVR
FT                   VVEPRRGANGWLDGIKRVAEHGCWPKLRCGGQTAESFPSVEVVSDFLAVASTLGVPFKV
FT                   TAGVHSAVRRTDPETGFTHHGFLNLLVATARSLSGKNVREALGSTDDAGLADEARSLSD
FT                   DAARAVRDVFASYGSASLTDPVTDLEGLELL"
     MPQAVVDHLA ARSGPYAGVM GPMLCQASRL AELITELAKA KPAEPVALSL VCDTGLGGVP        60
     KALSIIEGRQ ELLALRMVEM PAPSDVDDIW LERVSEFVPE DIVRVVEPRR GANGWLDGIK       120
     RVAEHGCWPK LRCGGQTAES FPSVEVVSDF LAVASTLGVP FKVTAGVHSA VRRTDPETGF       180
     THHGFLNLLV ATARSLSGKN VREALGSTDD AGLADEARSL SDDAARAVRD VFASYGSASL       240
     TDPVTDLEGL ELL                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page