(data stored in ACNUC1104 zone)

EMBL: AM420293.PE14

AM420293.PE14        Location/Qualifiers
FT   CDS             22287..25007
FT                   /transl_table=11
FT                   /locus_tag="SACE_0016"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /function="DNA-binding HTH domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99369"
FT                   /db_xref="GOA:A4F5P5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5P5"
FT                   /protein_id="CAL99369.1"
FT                   /translation="MHGRERERRAIRSILEDARSARGRALVLRGETGIGKSTLLKYAQR
FT                   RAAGMRLLSCSGLESESELAFSGLQHLVAPLLDEIDGLPPSQAEALRAALGMSELPVTE
FT                   FVVSAAVCSLLSYSARGTPLLVVVDDAQWLDRATLGALYFTARRIATEPIALLFGMGEA
FT                   EQHEREARDLPTMLLTGLSDEAADDLLDELGWNAPARDSLITATGGNPLALRELTRLGA
FT                   PEQLVGDALLLGTVPLSERLRTAFIQRMEGLPAKARALLLVVAVEETGRLGVVLGACAR
FT                   LGIDAGVLDSVLRGYDQLEITERWVRFRHSLMRSAAYHKASLRMRSKAHAAVAEELTDR
FT                   GESDRASWHRAMAAVEPDEELATALERSADTAERRGGSAAVVSVLQRAAKLSTDPEGRT
FT                   RRTASAAYAAWQSGQPDLARALTTEVMTAPTDMHARVGLTRLLGLIDLDSNDPAVACAQ
FT                   FVRGAQEVAEHNPEEALTLLFLAVDGGYLSGRIEDAGRAARLMTELDCGPDYRLLAERM
FT                   CAALEGRLPLEGTTPRELLDAAPALPTPDDEIRFLWVMAMSWLGPHQRQAREFGLAACR
FT                   TFRLKGVASVLPVMLNWVADTEYHLGLWRDGQAHAEEAVRLARDTGQRNRMADGLALLA
FT                   RFASVRGDWDGCRDHADAALETALVLRNRAAAAHVSWALGLADLARGRDADAYRRLSSI
FT                   RSEGSPYANSKVAALVHPDLVEAAVRCGHSDIAEVLLSEVREGCRGTTARWRKLHLHMC
FT                   RALVEESGADFATATGADLGEDRPFDRARAALLHGEWLRRNRRQAEARWQLQQAAELFD
FT                   SLGAAPWSERARGQLRAARGALLRTADPAVLTRQEKQIAGMAATGMTNKEIAAQLSVSP
FT                   RTVSHHLYKLFPKLGISSRAQLRGLDLESAPTQDG"
     MHGRERERRA IRSILEDARS ARGRALVLRG ETGIGKSTLL KYAQRRAAGM RLLSCSGLES        60
     ESELAFSGLQ HLVAPLLDEI DGLPPSQAEA LRAALGMSEL PVTEFVVSAA VCSLLSYSAR       120
     GTPLLVVVDD AQWLDRATLG ALYFTARRIA TEPIALLFGM GEAEQHEREA RDLPTMLLTG       180
     LSDEAADDLL DELGWNAPAR DSLITATGGN PLALRELTRL GAPEQLVGDA LLLGTVPLSE       240
     RLRTAFIQRM EGLPAKARAL LLVVAVEETG RLGVVLGACA RLGIDAGVLD SVLRGYDQLE       300
     ITERWVRFRH SLMRSAAYHK ASLRMRSKAH AAVAEELTDR GESDRASWHR AMAAVEPDEE       360
     LATALERSAD TAERRGGSAA VVSVLQRAAK LSTDPEGRTR RTASAAYAAW QSGQPDLARA       420
     LTTEVMTAPT DMHARVGLTR LLGLIDLDSN DPAVACAQFV RGAQEVAEHN PEEALTLLFL       480
     AVDGGYLSGR IEDAGRAARL MTELDCGPDY RLLAERMCAA LEGRLPLEGT TPRELLDAAP       540
     ALPTPDDEIR FLWVMAMSWL GPHQRQAREF GLAACRTFRL KGVASVLPVM LNWVADTEYH       600
     LGLWRDGQAH AEEAVRLARD TGQRNRMADG LALLARFASV RGDWDGCRDH ADAALETALV       660
     LRNRAAAAHV SWALGLADLA RGRDADAYRR LSSIRSEGSP YANSKVAALV HPDLVEAAVR       720
     CGHSDIAEVL LSEVREGCRG TTARWRKLHL HMCRALVEES GADFATATGA DLGEDRPFDR       780
     ARAALLHGEW LRRNRRQAEA RWQLQQAAEL FDSLGAAPWS ERARGQLRAA RGALLRTADP       840
     AVLTRQEKQI AGMAATGMTN KEIAAQLSVS PRTVSHHLYK LFPKLGISSR AQLRGLDLES       900
     APTQDG                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page