(data stored in SCRATCH zone)

EMBL: AM420293.PE140

AM420293.PE140       Location/Qualifiers
FT   CDS             167948..169483
FT                   /transl_table=11
FT                   /locus_tag="SACE_0142"
FT                   /product="putative cytochrome ubiquinol oxidase subunit"
FT                   /function="Cytochrome bd-type quinol oxidase, subunit 1"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99495"
FT                   /db_xref="GOA:A4F621"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:A4F621"
FT                   /protein_id="CAL99495.1"
FT                   /translation="MDLLDIARWQFGITTVYHFLMVPLTIGLSILVAGMQTAWYRTGDR
FT                   RYLKMTKFWGKLMLINFAMGVVTGIVQEFQFGMSWSAYSRFVGDVFGAPLAMEGLVAFF
FT                   VESTFLGLWIFGWDRLSKGVHLACAWAFSLATVASAYFILAANSWMQHPVGIVFTDGRP
FT                   RLDSIWAVLTNNTVLAAFPHTVFGCFAVAGAFLVGISAWQIWKHHRDTVGKNPGLERRT
FT                   EEQNEDRKVWHGSLRLGAWVGVIAFAGLAISGDLQAKLMFEQQPMKMASAEALCHTEQP
FT                   AGFSIFAIGDVGQSNCEDVKSLTVPYLLSYLANGDLHSEVRGVQQLIGEYQAAYGSHYP
FT                   DDPRLGPYAGKPVDYVPNLPVTYWGFRFMIGFGAVAAAGAVVVLWLTRKGRYPKWRWWT
FT                   PLAVLSIATPYLGNSFGWIFTEMGRQPFVVAPNPNPSGVDGVFMYTATAVSSGVTPGEM
FT                   LTSLIGLTSIYGVLAVVEIFLIVRYVRGGIAGVLPPEPPEGKKESDEALSFAY"
     MDLLDIARWQ FGITTVYHFL MVPLTIGLSI LVAGMQTAWY RTGDRRYLKM TKFWGKLMLI        60
     NFAMGVVTGI VQEFQFGMSW SAYSRFVGDV FGAPLAMEGL VAFFVESTFL GLWIFGWDRL       120
     SKGVHLACAW AFSLATVASA YFILAANSWM QHPVGIVFTD GRPRLDSIWA VLTNNTVLAA       180
     FPHTVFGCFA VAGAFLVGIS AWQIWKHHRD TVGKNPGLER RTEEQNEDRK VWHGSLRLGA       240
     WVGVIAFAGL AISGDLQAKL MFEQQPMKMA SAEALCHTEQ PAGFSIFAIG DVGQSNCEDV       300
     KSLTVPYLLS YLANGDLHSE VRGVQQLIGE YQAAYGSHYP DDPRLGPYAG KPVDYVPNLP       360
     VTYWGFRFMI GFGAVAAAGA VVVLWLTRKG RYPKWRWWTP LAVLSIATPY LGNSFGWIFT       420
     EMGRQPFVVA PNPNPSGVDG VFMYTATAVS SGVTPGEMLT SLIGLTSIYG VLAVVEIFLI       480
     VRYVRGGIAG VLPPEPPEGK KESDEALSFA Y                                      511
//

If you have problems or comments...

PBIL Back to PBIL home page