(data stored in ACNUC1104 zone)

EMBL: AM420293.PE147

AM420293.PE147       Location/Qualifiers
FT   CDS             178272..178754
FT                   /transl_table=11
FT                   /locus_tag="SACE_0150"
FT                   /product="heat shock protein HSP20"
FT                   /function="Molecular chaperone (small heat shock protein)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99502"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:A4F628"
FT                   /protein_id="CAL99502.1"
FT                   /translation="MTLVRRSSWDPFGNLVRQMDRDFDSISRRFFGSQGVEGFVPATNV
FT                   ERDGSDVVIKLELPGVDIAQDVEVEVTDGRLSISGQRRTEKTSGEDGAVLLREIRTGAF
FT                   RREFNLPEGVTAEQVEANYDRGVLEVRVHEVSKPAPAPTKIQIADRRQGDGKAELN"
     MTLVRRSSWD PFGNLVRQMD RDFDSISRRF FGSQGVEGFV PATNVERDGS DVVIKLELPG        60
     VDIAQDVEVE VTDGRLSISG QRRTEKTSGE DGAVLLREIR TGAFRREFNL PEGVTAEQVE       120
     ANYDRGVLEV RVHEVSKPAP APTKIQIADR RQGDGKAELN                             160
//

If you have problems or comments...

PBIL Back to PBIL home page