(data stored in SCRATCH zone)

EMBL: AM420293.PE15

AM420293.PE15        Location/Qualifiers
FT   CDS             complement(25251..26165)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0017"
FT                   /product="hypothetical protein"
FT                   /function="O-Methyltransferase involved in polyketide
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99370"
FT                   /db_xref="GOA:A4F5P6"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5P6"
FT                   /protein_id="CAL99370.1"
FT                   /translation="MTLAGKVRAAKGATSPTAELCAVIRAAETQQPERSRLLDDPFAQY
FT                   FLQNWRFRTTHPFPPVFRLCLRMADRRYTGLLAEVVLRHRFCDEVVEAEVAAGCTQVVL
FT                   LGAGYDTTALRHDFGPGVVVYEVDKPDTQAEKTAIMRRNSLRPKGRVQYVTCDFAAGDD
FT                   LGERLTSQGFDPALPSVVLWMGVTYYLPGDSVLDTLGKLGAITAPGSKVVLDYMDASVV
FT                   SGSGDDSARRARQLVASGGEPFVFGVESDDIRAFCDAGGFGVAEHHRIPDLLRRYGDDD
FT                   RFWLTVVDYMGVVVLEKENAPAA"
     MTLAGKVRAA KGATSPTAEL CAVIRAAETQ QPERSRLLDD PFAQYFLQNW RFRTTHPFPP        60
     VFRLCLRMAD RRYTGLLAEV VLRHRFCDEV VEAEVAAGCT QVVLLGAGYD TTALRHDFGP       120
     GVVVYEVDKP DTQAEKTAIM RRNSLRPKGR VQYVTCDFAA GDDLGERLTS QGFDPALPSV       180
     VLWMGVTYYL PGDSVLDTLG KLGAITAPGS KVVLDYMDAS VVSGSGDDSA RRARQLVASG       240
     GEPFVFGVES DDIRAFCDAG GFGVAEHHRI PDLLRRYGDD DRFWLTVVDY MGVVVLEKEN       300
     APAA                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page