(data stored in ACNUC1104 zone)

EMBL: AM420293.PE152

AM420293.PE152       Location/Qualifiers
FT   CDS             complement(181682..182680)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0155"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99507"
FT                   /db_xref="GOA:A4F633"
FT                   /db_xref="InterPro:IPR026004"
FT                   /db_xref="UniProtKB/TrEMBL:A4F633"
FT                   /protein_id="CAL99507.1"
FT                   /translation="MADTDSPTRTSRRKPHTRLVMISAAIGAMLILLISALLNWPTGGD
FT                   GVGGPGRIGSAPAPRAVFSAKAGTCLNWTEPDAADIRQVTCSEPHLFEVTGTADLKGEF
FT                   GPQAPFPDTEQWQQLKTDRCTQVSTQFLSGRFDPHGRFAVGAFTPSEQGWAEGDRTLHC
FT                   GLQQPGPSGKLYRISGNASKIDQSNVYDEGRCLGINGTAVWDPVDCSQLHSVEITGVVD
FT                   LGQQFPEGFPAVPDQDNFLATRCGELTAAYAGGPNVVRDKGLTTYWDTLPMESWDAGSR
FT                   KVNCKVSAQLPDGSGLAPVTGGVKGEVRVDKEPAPEDAAPVQPGVPAEGER"
     MADTDSPTRT SRRKPHTRLV MISAAIGAML ILLISALLNW PTGGDGVGGP GRIGSAPAPR        60
     AVFSAKAGTC LNWTEPDAAD IRQVTCSEPH LFEVTGTADL KGEFGPQAPF PDTEQWQQLK       120
     TDRCTQVSTQ FLSGRFDPHG RFAVGAFTPS EQGWAEGDRT LHCGLQQPGP SGKLYRISGN       180
     ASKIDQSNVY DEGRCLGING TAVWDPVDCS QLHSVEITGV VDLGQQFPEG FPAVPDQDNF       240
     LATRCGELTA AYAGGPNVVR DKGLTTYWDT LPMESWDAGS RKVNCKVSAQ LPDGSGLAPV       300
     TGGVKGEVRV DKEPAPEDAA PVQPGVPAEG ER                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page