(data stored in ACNUC1104 zone)

EMBL: AM420293.PE154

AM420293.PE154       Location/Qualifiers
FT   CDS             183493..184662
FT                   /transl_table=11
FT                   /locus_tag="SACE_0157"
FT                   /product="hypothetical protein"
FT                   /function="Glutathionylspermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99509"
FT                   /db_xref="InterPro:IPR005494"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A4F635"
FT                   /protein_id="CAL99509.1"
FT                   /translation="MRRRTTQRRPDWQSKVEELGLVFGTPARAADGSQRPYWDEGVHYE
FT                   FGLDEVLSLEADVELLHSMCLDAVDHVVTTERYRDFGIPEWVWPHIAESWKRHDPHLYG
FT                   RFDLRYDGSGPARLLEYNADTPTSLLEAAVVQWHWLTEVHEGDDQWNSIHEKLVERWEE
FT                   IGKQLGTNEVHFTWSGSDSTGEDNLTAAYLQETAAEAGLDTVGLAIEEIGWDSLLERFV
FT                   DLEEAPMSSVVKIYPWEWMVDDDFGTHAVKTLPQTQWIEPLWKMLLSNKALLAILWEMH
FT                   PGHPNLLPAYIGQPGLLTEYVRKPLLGREGNNISIVAPGWETETGGFYGEEGYVYQAFD
FT                   PLPEFDGMRPALGAWVVGDSSAGLGIRETAGLITDDGAAFVPHRIPDGS"
     MRRRTTQRRP DWQSKVEELG LVFGTPARAA DGSQRPYWDE GVHYEFGLDE VLSLEADVEL        60
     LHSMCLDAVD HVVTTERYRD FGIPEWVWPH IAESWKRHDP HLYGRFDLRY DGSGPARLLE       120
     YNADTPTSLL EAAVVQWHWL TEVHEGDDQW NSIHEKLVER WEEIGKQLGT NEVHFTWSGS       180
     DSTGEDNLTA AYLQETAAEA GLDTVGLAIE EIGWDSLLER FVDLEEAPMS SVVKIYPWEW       240
     MVDDDFGTHA VKTLPQTQWI EPLWKMLLSN KALLAILWEM HPGHPNLLPA YIGQPGLLTE       300
     YVRKPLLGRE GNNISIVAPG WETETGGFYG EEGYVYQAFD PLPEFDGMRP ALGAWVVGDS       360
     SAGLGIRETA GLITDDGAAF VPHRIPDGS                                         389
//

If you have problems or comments...

PBIL Back to PBIL home page