(data stored in SCRATCH zone)

EMBL: AM420293.PE156

AM420293.PE156       Location/Qualifiers
FT   CDS             complement(185988..186617)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0159"
FT                   /product="endonuclease III-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99511"
FT                   /db_xref="GOA:A4F637"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A4F637"
FT                   /protein_id="CAL99511.1"
FT                   /translation="MSTKTAVRDLLDRAGTTYAEEAGIKLEDKPAPLYRLLVLSVLLST
FT                   RIKAGIAVSAARELAEFGTPQKMRDATWQQRVDALGRGHYVRYDESTATSLGDGAEYLL
FT                   DRYRGDLRKLRDEAGGGIKALKSKLQEVKGLGPVGADIFCREAQAVWPELRPYFDKKAL
FT                   SGAKKVGLPEDAKRLAELVGDKDLARLAAALVRATLEKDVAEKVSA"
     MSTKTAVRDL LDRAGTTYAE EAGIKLEDKP APLYRLLVLS VLLSTRIKAG IAVSAARELA        60
     EFGTPQKMRD ATWQQRVDAL GRGHYVRYDE STATSLGDGA EYLLDRYRGD LRKLRDEAGG       120
     GIKALKSKLQ EVKGLGPVGA DIFCREAQAV WPELRPYFDK KALSGAKKVG LPEDAKRLAE       180
     LVGDKDLARL AAALVRATLE KDVAEKVSA                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page