(data stored in ACNUC1104 zone)

EMBL: AM420293.PE158

AM420293.PE158       Location/Qualifiers
FT   CDS             complement(187313..188125)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0161"
FT                   /product="Cof protein"
FT                   /function="predicted hydrolases of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99513"
FT                   /db_xref="GOA:A4F639"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4F639"
FT                   /protein_id="CAL99513.1"
FT                   /translation="MRKPGLVASDVDGTLLDSMERVSSRTAATVRRVVADDVPFVLVTG
FT                   RPPRWMPSVVAGLGVSGVAVCANGAVLYDTKADAVLASTEIDTVTLHDVVHELHHEMPG
FT                   CAVAVERTTGGAHDRVHEQFLAEEGFLQVWANSDIHVAAPDELVGKPAVKLLVLHDAMN
FT                   SAQMAAIAEEVVGDRLEMTYSTGAGIIEFSAAGVDKASGLRTVAADLGVDQADVIAFGD
FT                   MPNDVPMLSWVGHGVAMRNAHEAALAVADEVTATNNDNGVAQVLERWW"
     MRKPGLVASD VDGTLLDSME RVSSRTAATV RRVVADDVPF VLVTGRPPRW MPSVVAGLGV        60
     SGVAVCANGA VLYDTKADAV LASTEIDTVT LHDVVHELHH EMPGCAVAVE RTTGGAHDRV       120
     HEQFLAEEGF LQVWANSDIH VAAPDELVGK PAVKLLVLHD AMNSAQMAAI AEEVVGDRLE       180
     MTYSTGAGII EFSAAGVDKA SGLRTVAADL GVDQADVIAF GDMPNDVPML SWVGHGVAMR       240
     NAHEAALAVA DEVTATNNDN GVAQVLERWW                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page