(data stored in SCRATCH zone)

EMBL: AM420293.PE159

AM420293.PE159       Location/Qualifiers
FT   CDS             187923..189086
FT                   /transl_table=11
FT                   /locus_tag="SACE_0162"
FT                   /product="hypothetical protein"
FT                   /function="Coenzyme F420-dependent N5,N10-methylene
FT                   tetrahydromethanopterin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99514"
FT                   /db_xref="GOA:A4F640"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A4F640"
FT                   /protein_id="CAL99514.1"
FT                   /translation="MAHTATPDTPSPATTDGIQRGGLPVTSTKGTSSATTRRTVAAVRE
FT                   LTRSIESSSVPSTSEATRPGLRTAPSCPVAAARRTGVRPRPRRSRSPDTVRGVRVGIVI
FT                   LPEHRWWAAEPLWRMAEEYGFAHAWTYDHIGWRPGLERPWFDAVTTLTAAATVTSTLRI
FT                   GTFGSSPDFRHPVHYARQLTALDDISDGRLTLGLAAGGVDFDAHVLGGSELPASARVDR
FT                   FAEFVEVLDQVLVHDSTTYRGEYFTAVDARRAPGCVQPPRMPFAIAANGTRMMRLTARY
FT                   GRGWIAAGGYTDDLNTWWRAVADLSMRFTDVVAEEGGDPARIDRYLSLDAAPVYSLSSV
FT                   EYFREVVGRAHELGFTDVISHWPRPEEPYAGKESTVEEIASEVLPEL"
     MAHTATPDTP SPATTDGIQR GGLPVTSTKG TSSATTRRTV AAVRELTRSI ESSSVPSTSE        60
     ATRPGLRTAP SCPVAAARRT GVRPRPRRSR SPDTVRGVRV GIVILPEHRW WAAEPLWRMA       120
     EEYGFAHAWT YDHIGWRPGL ERPWFDAVTT LTAAATVTST LRIGTFGSSP DFRHPVHYAR       180
     QLTALDDISD GRLTLGLAAG GVDFDAHVLG GSELPASARV DRFAEFVEVL DQVLVHDSTT       240
     YRGEYFTAVD ARRAPGCVQP PRMPFAIAAN GTRMMRLTAR YGRGWIAAGG YTDDLNTWWR       300
     AVADLSMRFT DVVAEEGGDP ARIDRYLSLD AAPVYSLSSV EYFREVVGRA HELGFTDVIS       360
     HWPRPEEPYA GKESTVEEIA SEVLPEL                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page