(data stored in ACNUC1104 zone)

EMBL: AM420293.PE161

AM420293.PE161       Location/Qualifiers
FT   CDS             complement(190310..191563)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99516"
FT                   /db_xref="GOA:A4F642"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:A4F642"
FT                   /protein_id="CAL99516.1"
FT                   /translation="MTRTRERYLLATAIVLQVLSIWFVHWIDTRGYMDTDIYRLGARAW
FT                   LTGHEVYGDDLTPESPDSGTLPFIYPPFAAILFTPLTWMSSDAAVVTVAVCSHLALLLT
FT                   AYSLARSSTYLANRAGQVAVVTAVLMPLLTLIEPTRETLNYGQINLVLMALVAADCLLP
FT                   RTRWPRGLLVGIAAAIKLTPLGFLLLFLLRRDFRAAAVAGVTFAATVLLGLLAAPDDSA
FT                   DWWLDKMLSTGDSLGTVYAGNLTLRSLLAKQELTGLPLNVLWVAGSLVLLALAVLGIRY
FT                   ALRVRNVPLALMVNAVLVLLVSPISWSHHWVWAGPVLALLFAMSVRHRWYGVLLSTGLG
FT                   ALTVLVGPQWFLPNTDDRELDWTFSQQIVGNAYTLLGIAFLIAAAVAHFRMHPPIHRPP
FT                   EAARHEPAPSHGRPNLPA"
     MTRTRERYLL ATAIVLQVLS IWFVHWIDTR GYMDTDIYRL GARAWLTGHE VYGDDLTPES        60
     PDSGTLPFIY PPFAAILFTP LTWMSSDAAV VTVAVCSHLA LLLTAYSLAR SSTYLANRAG       120
     QVAVVTAVLM PLLTLIEPTR ETLNYGQINL VLMALVAADC LLPRTRWPRG LLVGIAAAIK       180
     LTPLGFLLLF LLRRDFRAAA VAGVTFAATV LLGLLAAPDD SADWWLDKML STGDSLGTVY       240
     AGNLTLRSLL AKQELTGLPL NVLWVAGSLV LLALAVLGIR YALRVRNVPL ALMVNAVLVL       300
     LVSPISWSHH WVWAGPVLAL LFAMSVRHRW YGVLLSTGLG ALTVLVGPQW FLPNTDDREL       360
     DWTFSQQIVG NAYTLLGIAF LIAAAVAHFR MHPPIHRPPE AARHEPAPSH GRPNLPA          417
//

If you have problems or comments...

PBIL Back to PBIL home page