(data stored in SCRATCH zone)

EMBL: AM420293.PE173

AM420293.PE173       Location/Qualifiers
FT   CDS             complement(203508..204134)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99528"
FT                   /db_xref="UniProtKB/TrEMBL:A4F654"
FT                   /protein_id="CAL99528.1"
FT                   /translation="MHPVLSGTAGILLLGCAAAVALAVFPLRGGKGQHAHAGPGTVTVE
FT                   HLCGARAEAESEDQEEIEWPRVDWDELSAREMIEFPAGRDDLPAAEAFPDPADVFPGLA
FT                   DAFPGVPDAFPEPAFLDVAAALPESADAFPDVTDAFPDLASAFRGAADPVDHEYVGRHR
FT                   LRCNDMLSHRLEWELINWPEPVRGPYKVDIAFVPPGVEILAPASH"
     MHPVLSGTAG ILLLGCAAAV ALAVFPLRGG KGQHAHAGPG TVTVEHLCGA RAEAESEDQE        60
     EIEWPRVDWD ELSAREMIEF PAGRDDLPAA EAFPDPADVF PGLADAFPGV PDAFPEPAFL       120
     DVAAALPESA DAFPDVTDAF PDLASAFRGA ADPVDHEYVG RHRLRCNDML SHRLEWELIN       180
     WPEPVRGPYK VDIAFVPPGV EILAPASH                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page