(data stored in ACNUC1104 zone)

EMBL: AM420293.PE180

AM420293.PE180       Location/Qualifiers
FT   CDS             complement(214925..215677)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99535"
FT                   /db_xref="GOA:A4F661"
FT                   /db_xref="InterPro:IPR008628"
FT                   /db_xref="UniProtKB/TrEMBL:A4F661"
FT                   /protein_id="CAL99535.1"
FT                   /translation="MSRALTLPEELLLLAHRESGKLRESTRVAAACAVAELGELALRGR
FT                   LLVRFEESALPGLRFFRFEHAVIELLAAERTGLWWADHLLAELLQRREAGPIPLDYKWV
FT                   RRHHDALPRHRAALAHRGLLRVEPATGLTRFIARERHRPDTAVRDALIAELRAPTAGRR
FT                   ALDARLLFLSDLVAAVGLHGELGISDRAFPRRMNPRRGIGVVTFRPEAMRDTSFALASA
FT                   VPTRSGSDGGGGDGGDGGGDGGGGGGGD"
     MSRALTLPEE LLLLAHRESG KLRESTRVAA ACAVAELGEL ALRGRLLVRF EESALPGLRF        60
     FRFEHAVIEL LAAERTGLWW ADHLLAELLQ RREAGPIPLD YKWVRRHHDA LPRHRAALAH       120
     RGLLRVEPAT GLTRFIARER HRPDTAVRDA LIAELRAPTA GRRALDARLL FLSDLVAAVG       180
     LHGELGISDR AFPRRMNPRR GIGVVTFRPE AMRDTSFALA SAVPTRSGSD GGGGDGGDGG       240
     GDGGGGGGGD                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page