(data stored in ACNUC1104 zone)

EMBL: AM420293.PE191

AM420293.PE191       Location/Qualifiers
FT   CDS             complement(226539..227873)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0194"
FT                   /product="FAD linked oxidase-like protein"
FT                   /function="FAD/FMN-containing dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99546"
FT                   /db_xref="GOA:A4F672"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A4F672"
FT                   /protein_id="CAL99546.1"
FT                   /translation="MGWARTSPTTARVVSTPDVEVIARAVREADERGVIARGLGRSYGD
FT                   VSQNAGGTVIDMTALNRIHDIDRDKAVVDVDAGVSLDQLMRAALPHGLWVPVLPGTRQV
FT                   TIGGAIGCDIHGKNHHSHGSFGNHVVSMDLLTADGQIRTLTPDGEGSELFWATVGGVGL
FT                   TGIVLRAKVKMKRTESAYFIVDADRTKDLDETLELFSNGSDMNYDYSMAWFDAISTGPK
FT                   LGRSAFSRGSLAKLDELPPKLRADPLKFDAPQLLTFPDVFPNGLANKLTFSTLSEIWYR
FT                   KTPKQGRGQVQNLTAFYHPLDMFGEWNRAYGSKGFLQYQFIVPFEEDEALRRLVQRIAE
FT                   SGHVSFLNVLKRMGDSSRAPLSFPIPGWTITVDFPIKDGLHRFCEELDEMVLGAGGRLY
FT                   FAKDSRTTPEMVRQMYPRLDEWRQVRAAVDPEGIFNSDLSRRLSL"
     MGWARTSPTT ARVVSTPDVE VIARAVREAD ERGVIARGLG RSYGDVSQNA GGTVIDMTAL        60
     NRIHDIDRDK AVVDVDAGVS LDQLMRAALP HGLWVPVLPG TRQVTIGGAI GCDIHGKNHH       120
     SHGSFGNHVV SMDLLTADGQ IRTLTPDGEG SELFWATVGG VGLTGIVLRA KVKMKRTESA       180
     YFIVDADRTK DLDETLELFS NGSDMNYDYS MAWFDAISTG PKLGRSAFSR GSLAKLDELP       240
     PKLRADPLKF DAPQLLTFPD VFPNGLANKL TFSTLSEIWY RKTPKQGRGQ VQNLTAFYHP       300
     LDMFGEWNRA YGSKGFLQYQ FIVPFEEDEA LRRLVQRIAE SGHVSFLNVL KRMGDSSRAP       360
     LSFPIPGWTI TVDFPIKDGL HRFCEELDEM VLGAGGRLYF AKDSRTTPEM VRQMYPRLDE       420
     WRQVRAAVDP EGIFNSDLSR RLSL                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page