(data stored in ACNUC1104 zone)

EMBL: AM420293.PE193

AM420293.PE193       Location/Qualifiers
FT   CDS             229404..229853
FT                   /transl_table=11
FT                   /locus_tag="SACE_0196"
FT                   /product="GtrA-like protein"
FT                   /function="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99548"
FT                   /db_xref="GOA:A4F674"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:A4F674"
FT                   /protein_id="CAL99548.1"
FT                   /translation="MAVAEPAAEQAANPEVKRLGVFNQLIRFVVVGGGCAIIDYGTYMA
FT                   LLAGLGWPAWVSKTISFILGTTASYLINRKFTFSGAGTGNAGAKAGAFAVLYTVTFFVN
FT                   VGTNQLLIWLTSPYANWQFTLIWVVAQGLGTLINFVMLKWVVFRD"
     MAVAEPAAEQ AANPEVKRLG VFNQLIRFVV VGGGCAIIDY GTYMALLAGL GWPAWVSKTI        60
     SFILGTTASY LINRKFTFSG AGTGNAGAKA GAFAVLYTVT FFVNVGTNQL LIWLTSPYAN       120
     WQFTLIWVVA QGLGTLINFV MLKWVVFRD                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page