(data stored in ACNUC1104 zone)

EMBL: AM420293.PE197

AM420293.PE197       Location/Qualifiers
FT   CDS             complement(234848..235666)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0200"
FT                   /product="putative ABC transport system, ATP-binding
FT                   protein"
FT                   /function="ABC-type polysaccharide/polyol phosphate
FT                   transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99552"
FT                   /db_xref="GOA:A4F678"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F678"
FT                   /protein_id="CAL99552.1"
FT                   /translation="MVSIDVWNAAVDFPIFDAKSRSLKKAVLGKAGGRIGTDSRVPIIE
FT                   ALHDINLSLRHGDRVALVGHNGAGKSTLLRLLAGIYEPTRGSARVVGKVAPVFDLGVGM
FT                   DPEISGYENIIIRGLFLGMNRKQMEARIDEIAEFTELGDYLEMPLRTYSTGMRVRLALG
FT                   VVTSIDPEILILDEGIGAVDADFLEKARDRLNDLVKRSGILVFASHSDEFLIELCNTAL
FT                   WMDKGGIKERGSLRSVLTHYKGHDPFENLSEETLARIGESAASIGSEEGS"
     MVSIDVWNAA VDFPIFDAKS RSLKKAVLGK AGGRIGTDSR VPIIEALHDI NLSLRHGDRV        60
     ALVGHNGAGK STLLRLLAGI YEPTRGSARV VGKVAPVFDL GVGMDPEISG YENIIIRGLF       120
     LGMNRKQMEA RIDEIAEFTE LGDYLEMPLR TYSTGMRVRL ALGVVTSIDP EILILDEGIG       180
     AVDADFLEKA RDRLNDLVKR SGILVFASHS DEFLIELCNT ALWMDKGGIK ERGSLRSVLT       240
     HYKGHDPFEN LSEETLARIG ESAASIGSEE GS                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page