(data stored in SCRATCH zone)

EMBL: AM420293.PE202

AM420293.PE202       Location/Qualifiers
FT   CDS             241628..242827
FT                   /transl_table=11
FT                   /locus_tag="SACE_0205"
FT                   /product="phytase"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /EC_number="3.1.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99557"
FT                   /db_xref="GOA:A4F683"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A4F683"
FT                   /protein_id="CAL99557.1"
FT                   /translation="MKRTVLAVSAVVAATASVTAPAVASPEPADIPGLVRFATFNASLN
FT                   RATEGELLADLSTPDDEQARKVAEVVQRNRPDVVLLNEFDHVPGGAAVDAFRANYLAVG
FT                   HNGAQPVDYPYAYTAPVNTGVPSGMDLDNDGSTGGPGDAYGFGQFPGQYGMVVLSKHPI
FT                   GDVRTFQNFRWTDMPGAMLPDDPATPEPADWYSPREKEALRLSSKSHWDLPIHVGGRTV
FT                   HLLASHPTPPSFDGPEDRNGVRNHDEIRFWADYVAGAGYVYDDAGRTGGLERGAPFVIA
FT                   GDQNADPNDGDSADRAATQLLNAQRVVDPRPGSFGAVEAARNQGGANTGHRGAPFFDTA
FT                   DFGDQSPGNLRVDYVLPSLPLVALRSGVFWPGGHDELSRLNDTSDHHLVWVDVLAAYHD
FT                   "
     MKRTVLAVSA VVAATASVTA PAVASPEPAD IPGLVRFATF NASLNRATEG ELLADLSTPD        60
     DEQARKVAEV VQRNRPDVVL LNEFDHVPGG AAVDAFRANY LAVGHNGAQP VDYPYAYTAP       120
     VNTGVPSGMD LDNDGSTGGP GDAYGFGQFP GQYGMVVLSK HPIGDVRTFQ NFRWTDMPGA       180
     MLPDDPATPE PADWYSPREK EALRLSSKSH WDLPIHVGGR TVHLLASHPT PPSFDGPEDR       240
     NGVRNHDEIR FWADYVAGAG YVYDDAGRTG GLERGAPFVI AGDQNADPND GDSADRAATQ       300
     LLNAQRVVDP RPGSFGAVEA ARNQGGANTG HRGAPFFDTA DFGDQSPGNL RVDYVLPSLP       360
     LVALRSGVFW PGGHDELSRL NDTSDHHLVW VDVLAAYHD                              399
//

If you have problems or comments...

PBIL Back to PBIL home page