(data stored in ACNUC1104 zone)

EMBL: AM420293.PE204

AM420293.PE204       Location/Qualifiers
FT   CDS             complement(243674..244657)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0207"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /function="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99559"
FT                   /db_xref="GOA:A4F685"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F685"
FT                   /protein_id="CAL99559.1"
FT                   /translation="MTSAVEVVDLVKRYPKSASNAVDGLSFEVSPGEVFGLLGPNGAGK
FT                   TTTVGILTTRVLLTSGTARVAGIDVAADPVAARGKVAVVPQRVNLDRSLNARQNLVWHA
FT                   NYHGVGRSERHRLADELLERMGLSGKAKARVDDLSGGQAQRLMIARALIHRPEVLFLDE
FT                   PSTGLDPQARLFVHDRVTELRADGVTVVLTTHDMDEAEKLSDRVGIVDHGKLLTLDTPE
FT                   KLIKSLPGSGTLAVTVLSAGVDEHELSELLCAVRGVERVESVSAGQTAEAEPELRLRLY
FT                   VEGEPSALLGPVAQALHQRQVPIIDLSPGSATLEDVFIELTGRELR"
     MTSAVEVVDL VKRYPKSASN AVDGLSFEVS PGEVFGLLGP NGAGKTTTVG ILTTRVLLTS        60
     GTARVAGIDV AADPVAARGK VAVVPQRVNL DRSLNARQNL VWHANYHGVG RSERHRLADE       120
     LLERMGLSGK AKARVDDLSG GQAQRLMIAR ALIHRPEVLF LDEPSTGLDP QARLFVHDRV       180
     TELRADGVTV VLTTHDMDEA EKLSDRVGIV DHGKLLTLDT PEKLIKSLPG SGTLAVTVLS       240
     AGVDEHELSE LLCAVRGVER VESVSAGQTA EAEPELRLRL YVEGEPSALL GPVAQALHQR       300
     QVPIIDLSPG SATLEDVFIE LTGRELR                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page