(data stored in ACNUC1104 zone)

EMBL: AM420293.PE207

AM420293.PE207       Location/Qualifiers
FT   CDS             complement(246108..246566)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99562"
FT                   /db_xref="UniProtKB/TrEMBL:A4F688"
FT                   /protein_id="CAL99562.1"
FT                   /translation="MTAFLHTPVKALRCASSPQREHPPLATTRPRPLLAADPRRRTTVL
FT                   LVFPPHGQQPRIDLRPAHLRTFLFDGVGHAPRLVPVQAPRLSRAQVLTFGGRRSSAAGS
FT                   AARQIRTPLLHFGHTRRPPTRHPVDLDVRHGERVRGVRSMAFAPLGHR"
     MTAFLHTPVK ALRCASSPQR EHPPLATTRP RPLLAADPRR RTTVLLVFPP HGQQPRIDLR        60
     PAHLRTFLFD GVGHAPRLVP VQAPRLSRAQ VLTFGGRRSS AAGSAARQIR TPLLHFGHTR       120
     RPPTRHPVDL DVRHGERVRG VRSMAFAPLG HR                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page