(data stored in ACNUC1104 zone)

EMBL: AM420293.PE211

AM420293.PE211       Location/Qualifiers
FT   CDS             249825..251354
FT                   /transl_table=11
FT                   /locus_tag="SACE_0214"
FT                   /product="cationic amino acid transport protein"
FT                   /function="Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99566"
FT                   /db_xref="GOA:A4F692"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A4F692"
FT                   /protein_id="CAL99566.1"
FT                   /translation="MPGNGLLRTKSIERSIRDTDEPNSKLKKSLGAFDLTVFGVAVVVG
FT                   AGIFSVAASTAGNMAGPSVSLAFIMAAVTCGLAALCYAEFASTVPVAGSAYTFSYATFG
FT                   ELIAWIIGWDLVLEFAVAASVISKSWSSYLAEVLGLAGADLSPVTTVGPVTVDWGAMFI
FT                   AGLITVLLVAGTKLSSRVNQVITAIKVTVVLVVIVVGIGYVNPKNYTPFIPPAAPSAGA
FT                   DAGATGLDQSLLSLLFGGAGSTYGTFGLLAAASTVFFAFIGFDIVATAAEETRDPKRDM
FT                   PRGILGSLVIVTVLYVAVSLVVTGMSHYTTLKDRPDGSSATLATAFADHGVTWVAGFIS
FT                   VAAMIGLMTVVMVLIMGQSRVLFAMSRDGLLPKAASKTGERGTPARATAFVGVVVALVS
FT                   GLFDTNVLAELVNVGTLFAFAMVSVGVIVLRRTRPDLERGFRTPFVPVVPVLAVLACLW
FT                   LMINLTVFTWVWFFVWLVLGLAVYFAYGRRHSVLGRRQAEAGREEQPVEAG"
     MPGNGLLRTK SIERSIRDTD EPNSKLKKSL GAFDLTVFGV AVVVGAGIFS VAASTAGNMA        60
     GPSVSLAFIM AAVTCGLAAL CYAEFASTVP VAGSAYTFSY ATFGELIAWI IGWDLVLEFA       120
     VAASVISKSW SSYLAEVLGL AGADLSPVTT VGPVTVDWGA MFIAGLITVL LVAGTKLSSR       180
     VNQVITAIKV TVVLVVIVVG IGYVNPKNYT PFIPPAAPSA GADAGATGLD QSLLSLLFGG       240
     AGSTYGTFGL LAAASTVFFA FIGFDIVATA AEETRDPKRD MPRGILGSLV IVTVLYVAVS       300
     LVVTGMSHYT TLKDRPDGSS ATLATAFADH GVTWVAGFIS VAAMIGLMTV VMVLIMGQSR       360
     VLFAMSRDGL LPKAASKTGE RGTPARATAF VGVVVALVSG LFDTNVLAEL VNVGTLFAFA       420
     MVSVGVIVLR RTRPDLERGF RTPFVPVVPV LAVLACLWLM INLTVFTWVW FFVWLVLGLA       480
     VYFAYGRRHS VLGRRQAEAG REEQPVEAG                                         509
//

If you have problems or comments...

PBIL Back to PBIL home page