(data stored in SCRATCH zone)

EMBL: AM420293.PE217

AM420293.PE217       Location/Qualifiers
FT   CDS             258342..258455
FT                   /transl_table=11
FT                   /locus_tag="SACE_0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99572"
FT                   /db_xref="UniProtKB/TrEMBL:A4F698"
FT                   /protein_id="CAL99572.1"
FT                   /translation="MQRLARELSDQLEHAVAQAREPDEDQLRFNARPPRLR"
     MQRLARELSD QLEHAVAQAR EPDEDQLRFN ARPPRLR                                 37
//

If you have problems or comments...

PBIL Back to PBIL home page