(data stored in ACNUC1104 zone)

EMBL: AM420293.PE218

AM420293.PE218       Location/Qualifiers
FT   CDS             258851..259453
FT                   /transl_table=11
FT                   /locus_tag="SACE_0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99573"
FT                   /db_xref="UniProtKB/TrEMBL:A4F699"
FT                   /protein_id="CAL99573.1"
FT                   /translation="MDHHDAVATPRDALRSLAGFCNDRPDRATPPSPAGGVRRSDRSDV
FT                   GCTHAESCPLFPFLKASLRGWREHYCDSEDRWLECARYQVARTGQHVPISLLPNGRDAH
FT                   YLAMAAEESRTAVTEPVRASDLGRAHQHERAAHERAARPEPRSTETTEQFGAVAQPKPP
FT                   PRSPEEPPSEPREPARRRKPEKRGWWRRLADWMRGPA"
     MDHHDAVATP RDALRSLAGF CNDRPDRATP PSPAGGVRRS DRSDVGCTHA ESCPLFPFLK        60
     ASLRGWREHY CDSEDRWLEC ARYQVARTGQ HVPISLLPNG RDAHYLAMAA EESRTAVTEP       120
     VRASDLGRAH QHERAAHERA ARPEPRSTET TEQFGAVAQP KPPPRSPEEP PSEPREPARR       180
     RKPEKRGWWR RLADWMRGPA                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page