(data stored in ACNUC1104 zone)

EMBL: AM420293.PE219

AM420293.PE219       Location/Qualifiers
FT   CDS             259450..260088
FT                   /transl_table=11
FT                   /locus_tag="SACE_0222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99574"
FT                   /db_xref="GOA:A4F6A0"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6A0"
FT                   /protein_id="CAL99574.1"
FT                   /translation="MSNYWPWWAGAVGLALVTINYTLITDRSLGVSSAWDRVLHWRAER
FT                   RHERHEARFADEGALADALAAATAEEFGDRSSTQDRGDDVRAQYVGSSAVEATSAASMR
FT                   PVPVVTQAALLLAIFAGGWVAAVTAGRFEVRFDMGAGFRDLVTADPNAMIGLLFAGGLL
FT                   VGFGTRLAGGCSSGHGLSGCGRLRPVSLVATAVFFGTAVLVSFLLWKVV"
     MSNYWPWWAG AVGLALVTIN YTLITDRSLG VSSAWDRVLH WRAERRHERH EARFADEGAL        60
     ADALAAATAE EFGDRSSTQD RGDDVRAQYV GSSAVEATSA ASMRPVPVVT QAALLLAIFA       120
     GGWVAAVTAG RFEVRFDMGA GFRDLVTADP NAMIGLLFAG GLLVGFGTRL AGGCSSGHGL       180
     SGCGRLRPVS LVATAVFFGT AVLVSFLLWK VV                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page