(data stored in ACNUC1104 zone)

EMBL: AM420293.PE225

AM420293.PE225       Location/Qualifiers
FT   CDS             263328..264521
FT                   /transl_table=11
FT                   /locus_tag="SACE_0228"
FT                   /product="chloramphenicol resistance protein"
FT                   /function="Arabinose efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99580"
FT                   /db_xref="GOA:A4F6A6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6A6"
FT                   /protein_id="CAL99580.1"
FT                   /translation="MPLRLLVLAVGTFVINTGSYLVAGVLPSIAGAVGVPVTTAGQLIT
FT                   MHALTYAVSAPVLSTLAGRWERRRLLWVSLGLFVLGNIATAVAPDFASLTAARVLGALG
FT                   ASMFTPTAVVIAADLVPLDRRGRAVSMVLSGLTLATVVGVPMGVLLEGMLGYRGLFWIV
FT                   ALLGVLASVALLALPRVPAPPAARFGERLSVLRDRTVVWVLAVSLLGSLADFAAYTYAS
FT                   PMLSALTGAGAGTLGALLFVYGVAGATGNAVVGRITDRFGSGVGIAGSLLALAAGLALL
FT                   PLAGSATWAVAGLLVLWGLGGWGIMPAIQHRLINLTPASAAVVIAFNSSALYLGMGLGG
FT                   ITGGAVAAAWGWAALGPASAVVSVLALVLFWRLPAPAARAAVPERARPEDVPVGASG"
     MPLRLLVLAV GTFVINTGSY LVAGVLPSIA GAVGVPVTTA GQLITMHALT YAVSAPVLST        60
     LAGRWERRRL LWVSLGLFVL GNIATAVAPD FASLTAARVL GALGASMFTP TAVVIAADLV       120
     PLDRRGRAVS MVLSGLTLAT VVGVPMGVLL EGMLGYRGLF WIVALLGVLA SVALLALPRV       180
     PAPPAARFGE RLSVLRDRTV VWVLAVSLLG SLADFAAYTY ASPMLSALTG AGAGTLGALL       240
     FVYGVAGATG NAVVGRITDR FGSGVGIAGS LLALAAGLAL LPLAGSATWA VAGLLVLWGL       300
     GGWGIMPAIQ HRLINLTPAS AAVVIAFNSS ALYLGMGLGG ITGGAVAAAW GWAALGPASA       360
     VVSVLALVLF WRLPAPAARA AVPERARPED VPVGASG                                397
//

If you have problems or comments...

PBIL Back to PBIL home page