(data stored in ACNUC1104 zone)

EMBL: AM420293.PE229

AM420293.PE229       Location/Qualifiers
FT   CDS             267550..268608
FT                   /transl_table=11
FT                   /locus_tag="SACE_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99584"
FT                   /db_xref="InterPro:IPR023869"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6B0"
FT                   /protein_id="CAL99584.1"
FT                   /translation="MPSSMVTAHEAPLNSSADPARQPDSARPAIGWPPAYFAPGSRLRT
FT                   SASTGSFTLTTSVSHASGACQATWRSTSRTAVSGVATTTSASSAAALRSASSALSSTAK
FT                   PSARAASASGREAVAPHAGRPAAEAARSTEPPISPSPMTHTARMATILPEPPPAGPRTR
FT                   MSGNPSPEGYERAIVLSGGVRTLYGVLMTDQEPVAGFAVAVVREDGRWRCSAMDSSVLA
FT                   GLDTAITELRGLRSTGAVFGMCNVDDEFFVLIRPVPGGVDLLLSDAAAALDYDIAADVL
FT                   DLLRIDPPDEDDDEVWPEGNLAILSDIGLPEGELLVIIEEVDLYPDEQLEMIAQRCGFG
FT                   EQFAGLMEKLDQ"
     MPSSMVTAHE APLNSSADPA RQPDSARPAI GWPPAYFAPG SRLRTSASTG SFTLTTSVSH        60
     ASGACQATWR STSRTAVSGV ATTTSASSAA ALRSASSALS STAKPSARAA SASGREAVAP       120
     HAGRPAAEAA RSTEPPISPS PMTHTARMAT ILPEPPPAGP RTRMSGNPSP EGYERAIVLS       180
     GGVRTLYGVL MTDQEPVAGF AVAVVREDGR WRCSAMDSSV LAGLDTAITE LRGLRSTGAV       240
     FGMCNVDDEF FVLIRPVPGG VDLLLSDAAA ALDYDIAADV LDLLRIDPPD EDDDEVWPEG       300
     NLAILSDIGL PEGELLVIIE EVDLYPDEQL EMIAQRCGFG EQFAGLMEKL DQ               352
//

If you have problems or comments...

PBIL Back to PBIL home page