(data stored in ACNUC1104 zone)

EMBL: AM420293.PE231

AM420293.PE231       Location/Qualifiers
FT   CDS             269255..269797
FT                   /transl_table=11
FT                   /locus_tag="SACE_0234"
FT                   /product="RNA polymerase sigma-70 factor, ECF family"
FT                   /function="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99586"
FT                   /db_xref="GOA:A4F6B2"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6B2"
FT                   /protein_id="CAL99586.1"
FT                   /translation="MLAARAAAGDEQAFAVFVRRHSDGVFALALRMLGDRVEAEDVVQD
FT                   VFVTVWRRVGELADFGAARAWLFQIARRQCLIVLRRKRIRRTYPVGSVPEHRPAVGAAR
FT                   GVADPQRMAEAGAGVCALGRALAGLPTRQRDVWLLAEVDGLSYVEIGQRVGAGEEAVRG
FT                   RLSRARATLADAMRAWR"
     MLAARAAAGD EQAFAVFVRR HSDGVFALAL RMLGDRVEAE DVVQDVFVTV WRRVGELADF        60
     GAARAWLFQI ARRQCLIVLR RKRIRRTYPV GSVPEHRPAV GAARGVADPQ RMAEAGAGVC       120
     ALGRALAGLP TRQRDVWLLA EVDGLSYVEI GQRVGAGEEA VRGRLSRARA TLADAMRAWR       180
//

If you have problems or comments...

PBIL Back to PBIL home page