(data stored in ACNUC1104 zone)

EMBL: AM420293.PE233

AM420293.PE233       Location/Qualifiers
FT   CDS             complement(272048..272542)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99588"
FT                   /db_xref="GOA:A4F6B4"
FT                   /db_xref="InterPro:IPR025325"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6B4"
FT                   /protein_id="CAL99588.1"
FT                   /translation="MRFRPPFRHRLPDVSEHGLEAAADIYAQRLRAFYDSRARWHRRFY
FT                   RFSGILVIAVGAGLPILTTQQFPGQDLVISIAGVTVAVSAGLRAFYRWDQSWILLRRTE
FT                   IALTDAHWQWKAGLGADPVANAENTQRFLEELGSLRRQESDSFFQDLSFPGSAEASRPQ
FT                   H"
     MRFRPPFRHR LPDVSEHGLE AAADIYAQRL RAFYDSRARW HRRFYRFSGI LVIAVGAGLP        60
     ILTTQQFPGQ DLVISIAGVT VAVSAGLRAF YRWDQSWILL RRTEIALTDA HWQWKAGLGA       120
     DPVANAENTQ RFLEELGSLR RQESDSFFQD LSFPGSAEAS RPQH                        164
//

If you have problems or comments...

PBIL Back to PBIL home page