(data stored in ACNUC1104 zone)

EMBL: AM420293.PE236

AM420293.PE236       Location/Qualifiers
FT   CDS             complement(276265..276591)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99591"
FT                   /db_xref="GOA:A4F6B7"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6B7"
FT                   /protein_id="CAL99591.1"
FT                   /translation="MTPLDITGRALAMLAALALLTAAAAAVVLWRAVLPVILIAALAVT
FT                   SGMVRTLALGGFAALAGLRGLMLALDRAGTAVPTPRLRRSPPAWIPQTAGAGHEPGNEH
FT                   PATE"
     MTPLDITGRA LAMLAALALL TAAAAAVVLW RAVLPVILIA ALAVTSGMVR TLALGGFAAL        60
     AGLRGLMLAL DRAGTAVPTP RLRRSPPAWI PQTAGAGHEP GNEHPATE                    108
//

If you have problems or comments...

PBIL Back to PBIL home page